SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005040688.1.66865 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005040688.1.66865
Domain Number 1 Region: 641-836
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000304
Further Details:      
 
Domain Number 2 Region: 456-568
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-18
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 10-92
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000134
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 253-293
Classification Level Classification E-value
Superfamily WW domain 0.0000000501
Family WW domain 0.0026
Further Details:      
 
Domain Number 5 Region: 358-387
Classification Level Classification E-value
Superfamily WW domain 0.0000325
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005040688.1.66865
Sequence length 838
Comment PREDICTED: rho GTPase-activating protein 12 isoform X1 [Ficedula albicollis]; AA=GCF_000247815.1; RF=representative genome; TAX=59894; STAX=59894; NAME=Ficedula albicollis; AL=Chromosome; RT=Major
Sequence
MADKGGKMLPGQLYIQVEYDYEYEAKDKKIVIKQGEKYILVKKTNDDWWQVKRDENSKPF
YVPAQYVKEIPRKALMPPVKQASMLPNNTLKVTHGLQRSTENVNKSPELSSFGKSSPVQV
SCLVRDANQNLGPNNSTCQTFGLSLDLTQNNGKLNNELQSPKVSNQFRTISMGHFPCPEF
LEIEKTSFLHEQSCDSAGEGSEKIHQDSESGDELSSSSTEQVQPTTPPSQGRPDSPVYAN
LQELKISQSALPPLPTSAPVQINGEWETHKDTTGRCYYYNRGSQERTWKPPRWARDASIN
KGDSQSHADHEHLSSEENDHSSCYSQSDSQYGSPPKGWSEELDEHGQTLYTNDYTNEKWI
KHADEQGRPYYYSADGSRSEWELPKYNASPQQQRDIIKSRSLDRRLQEPIVLTKWRHSTI
VLDTNDKESSTASKASFPENESSPSSPKHQATGQEKYGLLNVTKITENGKKVRKNWMSSW
AVLQGSSLLFTKTQGSGTGWKFGVNQSKPEFTVDLKGALIDWASKDKSSKKNVIELKTRQ
GTELLIQSDNDSFINEWYKVLNYTINNQVIESDEALDDEVPDSPGVEKQDKEKENKDSKK
LRSVKAPSSIDSTDQKKTKTKLKKFLTRRPTLQAVREKGYIKDQVFGSNLTSLCQRENST
VPKFVKLCIEHVEEHGLDIDGLYRVSGNLAVIQKLRFAVNHDEKLDLSDSKWEDIHVITG
ALKMFFRELPEPLFTYNHFNDFVNAIKQEPRQRVPAVKDLIKQLPKPNQDTMQVLFRHLK
RVVENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLELNSIFGR
Download sequence
Identical sequences U3JXB8
ENSFALP00000007422 XP_005040688.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]