SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005050827.1.66865 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005050827.1.66865
Domain Number 1 Region: 510-748,782-849
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.9e-55
Family Diacylglycerol kinase-like 0.018
Further Details:      
 
Domain Number 2 Region: 6-91,215-242
Classification Level Classification E-value
Superfamily EF-hand 3.1e-40
Family EF-hand modules in multidomain proteins 0.011
Further Details:      
 
Domain Number 3 Region: 218-330
Classification Level Classification E-value
Superfamily EF-hand 1.33e-21
Family Calmodulin-like 0.019
Further Details:      
 
Domain Number 4 Region: 311-380
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.73e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0035
Further Details:      
 
Domain Number 5 Region: 380-448
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005050827.1.66865
Sequence length 875
Comment PREDICTED: diacylglycerol kinase gamma isoform X1 [Ficedula albicollis]; AA=GCF_000247815.1; RF=representative genome; TAX=59894; STAX=59894; NAME=Ficedula albicollis; AL=Chromosome; RT=Major
Sequence
MSDGMWISLSPAEFAQLQQYTDYSTKKLKDVLEEFHGDGVLSRYNPEQPIDYEGFCLFMK
TYLEADVPEELCQHLFTSFKRKICQASPESQQQSPGVSQHSSLGINGKTLRGALGRHTPE
PKGCQSNTAEPQPASLTLASIPSASPSWSRSSSQKSTTGTASAHNSSGSSKISSVSVLSP
QSPGTRSTEKRLPFSLRKGPSSLKATPPPPPTPVAQVVHLKDIVCYLSLLERGRAEDKLE
FMFRLYDTDGNGVLDSSELDRIINQMVHVAEYLEWDSTELKPILKDMMEEIDYNHDGTVT
LEEWIRGGMTTIPLLVLLGMETNVKDDGQHAWRLKHFKKPAYCNFCRTMLLGVRKQGLCC
SFCKYTVHERCVSKDIASCISTYVKSKRNTSVMQHTWIEGNSPAKCDRCHKSIKCYQGIT
GLHCVWCQVTLHNKCASHVKPECDGGPLRDHILLPSSICPVVLDRQSHCRRSESDSPAST
SPEDSQGFKFNSTTVDGQGLQISPQPGTHPLLVFVNPKSGGRQGERVLRKFHYLLNPRQV
YNLDRGGPTPGLNFFRDTPDFRVLACGGDGTVGWILDCIDKANLVKHPPVAVLPLGTGND
LARCLRWGGGYEGGNLMKVLKDIEHSTEVMLDRWHIDIIPTDREANGDPVPSTIINNYFS
IGVDASIAHRFHIMREKHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDYVEVECDGTL
LDLSNTSLEGIAVLNIPSMYGGSNLWGETKKQRGYNRLGKKAPEKLPGTVVTDAKELKFC
VQDLSDHLLEVVGLEGAMEMGQIYTGLKSAGKRLAQCSSVIIRTSKLLPMQVDGEPWMQP
SCTVKITHKSQVPMLLGPPQKSSFFFLKRRNRTRD
Download sequence
Identical sequences U3JL51
ENSFALP00000003505 XP_005050827.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]