SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005063826.1.91757 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005063826.1.91757
Domain Number 1 Region: 135-208
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 5.89e-31
Family AN1-like Zinc finger 0.0000177
Further Details:      
 
Domain Number 2 Region: 13-54
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000185
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005063826.1.91757
Sequence length 213
Comment PREDICTED: AN1-type zinc finger protein 5 [Mesocricetus auratus]; AA=GCF_000349665.1; RF=representative genome; TAX=10036; STAX=10036; NAME=Mesocricetus auratus; AL=Scaffold; RT=Major
Sequence
MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPT
SDSASVQRADASLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVS
EPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRY
SDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI
Download sequence
Identical sequences A0A1U7QB20 A0A250YCB1 A4U9C9 L5K8G9
ENSSSCP00000005655 9823.ENSSSCP00000005655 NP_001090975.1.46622 XP_004383349.1.4749 XP_004439699.1.5094 XP_005063826.1.91757 XP_005352092.1.66349 XP_005660217.1.46622 XP_006918502.1.64745 XP_007120255.1.24612 XP_008511797.1.77740 XP_011369565.1.92234 XP_013203544.1.66349 XP_014590902.1.31192 XP_014650178.1.5094 XP_016005512.1.101085 XP_020041379.1.5219 XP_020041380.1.5219 XP_020957662.1.46622 XP_020958179.1.46622 XP_021060471.1.100879 ENSSSCP00000005655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]