SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005066155.1.91757 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005066155.1.91757
Domain Number 1 Region: 53-549
Classification Level Classification E-value
Superfamily Sema domain 1.09e-99
Family Sema domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1411-1536,1702-1858
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.16e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 891-982
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000789
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 4 Region: 981-1071
Classification Level Classification E-value
Superfamily E set domains 0.000000000000267
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.074
Further Details:      
 
Domain Number 5 Region: 1068-1150
Classification Level Classification E-value
Superfamily E set domains 0.0000000000369
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 
Domain Number 6 Region: 552-603
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000719
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005066155.1.91757
Sequence length 1926
Comment PREDICTED: plexin-D1 [Mesocricetus auratus]; AA=GCF_000349665.1; RF=representative genome; TAX=10036; STAX=10036; NAME=Mesocricetus auratus; AL=Scaffold; RT=Major
Sequence
MARRAAGGAPPSARAAAAAVPLLPRRHSRGPGLPPLPLLLLLGAARAGALEIQRRFPSPT
PTNNFALDGTAGTVYLAAVNRLYQLSSANLSVEAEATVGPVPDSPLCHAPQLPQSSCEHP
RRLTDNYNKILQLDPGQGLVVACGSIYQGLCQLRRRGNISALAVRFPPAAPPAEPVAVFP
SMLNVAANHPNASTVGLVLPPATSTGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPE
ISIRSLDARGNLAKLFTFDLNPSDDNILKIKQGAKEQYKLSFVSAFLHPAAPQHRAPPYA
YLALNSEARAGDKDSQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGSAGRGDLYSR
LVSIYPVRDLLFAVFERPQGAPGARNAPAALCVFRFADVQTAIRAARTACFVEPAPDVVA
VLDSVVQGTGPSCENKRNIQLQPEQLDCGAAHLQHPLSILQPLRASPVFRAPGLTAVAVA
GTNNYTAVFLGTATGRLLKVSLNESMQVVSRQVLTVAYGEPVHSVMQFDPMDPGFLYLMT
SHQIARVKVAACEVHSTCGDCVGAADAYCGWCTLETRCTLQQDCANSSQPHFWTSASEGP
GRCPAMTVLPSEIDVRWDYTGMILQISGSLPSLSGLEMACDYGNGVRTVARVPGSTYDHQ
IAYCNLLPRAQFPSFPAGQDHVTVEMSVRIKGRNIVSANFTIYDCGRIGQVYPHTACTSC
LSTQWPCFWCTQQHSCVSNQSRCEGSPDPTNPQDCPQILPSPLAPVPTGGSQDILVPLTS
ASFFHGTSLECSFGLEESFEAVWVNDSLVRCNQVVLHTTQKSQVFPLSLKLKGPPDRFLD
SPNPMTVTVYNCAVGSPDCSQCLGREDLGHLCVWNDGCRLRGPLQPLPGICPAPEIRAIE
PLSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGSVACDPLADRYTVSEEIVCVTGPAPGA
FSDVVTVNVSKEGRSREHFSYVLPVVHSLEPALGPKAGGTRITIHGSDLHVGSMLQVLVN
DTDHCTDLIRTATSITCTMPRGSLPALVPVCVRFESRGCVHGNLTFWYMQNPVITAIRPG
RSPVSGGRTITVAGERFHMVQNVSMAVYHIGREPTLCKVLNSTLITCPSPGALSNASAPV
DFFINGRAYTDDAAEELLDPAEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVI
HKEQDSLGLESHEYHIKIGQVSCDIQIVSDRVIHCSVNESLGTAEGQLPITIQVGNFNQT
IATLQLGGSETAIVVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIR
EEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEEKYVLPSQTLN
SQGSSPPQETHPLLGEWNIPEHCRASMEEGISVFSSLLNNKHFLIIFVHALEQQKDFAVR
DRCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMS
ICMYGCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLN
VSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYV
LRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLP
TDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKY
FFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSVIA
QAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAE
ESRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMENNIY
ECYSEA
Download sequence
Identical sequences A0A1U7Q6V6
XP_005066155.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]