SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005075031.2.91757 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005075031.2.91757
Domain Number 1 Region: 65-516
Classification Level Classification E-value
Superfamily Sema domain 3.53e-109
Family Sema domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1625-1752,1940-2126
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-45
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1194-1287
Classification Level Classification E-value
Superfamily E set domains 1.21e-17
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 4 Region: 1102-1197
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000252
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 5 Region: 519-570
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000288
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 1285-1400
Classification Level Classification E-value
Superfamily E set domains 0.000000000131
Family Other IPT/TIG domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005075031.2.91757
Sequence length 2159
Comment PREDICTED: plexin-B1 isoform X2 [Mesocricetus auratus]; AA=GCF_000349665.1; RF=representative genome; TAX=10036; STAX=10036; NAME=Mesocricetus auratus; AL=Scaffold; RT=Major
Sequence
MLSSPDPASPARTCAVLGSPGHLSLVNPGNLSVAQVTMPVLGPVLLQVLWAGCVLTLQSP
LPAAFTANGTHLQHLARDPTSGTLYVGATNFLFQLSPGLQLEAVVSTGPVNDSLDCLPPV
IPDECPLAQPTNNPNQLLLVSPEALVVCGSVHQGVCELRSLGQIGQLLLRPERPGDTQYV
AANDPAVSTVGLVAQGLLGEPLLFVGRGYTSKGVSGGIPPITTRALRPPDPQAAFSYEET
AKLAVGRLSEYSHHFVSAFVHGASAYFLFLRRDLKAPSRAFRAYVSRVCLQDQHYYSYVE
LPLACQGGRYGWIHAAAVTTSKEVARGEVLFAAFSSVAPPTVDWPLSASTGTSGTSVLCA
FPLDEVDQLANYTRDACYTREGLAENGTKVADIAYDVLSDCAQLPVDTPDAFPCGSDHTP
SPMVSCVPLEATPILELPGVQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGRSVAPYS
KQSIQPGSAVSRDLTFDGTFEHLYVATQTTLVKVPVAPCAQRLDCDSCLAHRDPYCGWCV
LLGRCSRRSECSRGQGPEQWLWSFQSELGCLRVVAVSPANISREERREVFLSVPGLPSLW
PGESYFCYFGDHQSPALLTGSGVMCPSPDPSEAPVLQRGADHVSVNVELRFGAVVIANAS
LSFYDCMAVTELFPSAPCRACVSSRWGCNWCVWQHLCTHKASCGAGPVVASQQSPLLSLV
PPAREALTPFPPTVPKASVTPTPNTFPVEPRAPSTVSDVLPGARPSRLSLWGPWAGPGPI
LSPTSTESPLHEKPLIPDLPTTPGTTVPTPTALEPVSTPEDLSASYSFPSDAATVSPSEP
GPEALPSTGTLDQPPGTAPATTFPGATGSMKPVVDWLVKEGGELPEADEWMGVDTPAFST
STLLSGDGDSAEHEGSPAPLILLSSLDYQYDTPGLWELGEMSQTVSSCPCVENVHGSLLI
PVHVERKIQLRGRNLWLFQDGPRNSECVLELEGLEVAVEAQVECEPPPDAWCHITCQQHQ
FSYKALQPELQVGLFLRWAGGLRVDSADGLYVVLYDCSVGHGDCSRCQTAMPQYGCVWCE
GEQPRCVAREACHEAETVATQCPAPLIHSVEPLTGPVDGGTRVTIRGSNLGQHVQDVLGM
VRVAGVPCAVDAGEYEVSSRLVCVTGTTVEEVAGAVAVEVPARGHSVSEVNFAYQDPKVH
SIFPDRGPRAGGTRLTLHGSKLLTGRPEDIRVLIGDQPCHLLLEQQQSEQLCCETSPYPM
PAALPVTVWFGTTERRLQRGQFTYTSDPNVTSVGPTKSFFSGGREIWVRGQNLDVVLMPR
IRVTVVPRTPQPGQGLGQRHHVVPEEIEEPCLVNSSRLIMCRTPALPGPPEDPWVQVEFI
LDNVVFDFATLSPVPFSYEADPTLHSLNPEDPTTPFRHKPGSVFSVEGENLDLAMSKEEV
VAMIGDGPCVVKTLTRHHLYCEPPVEQPLPQHHALQEAPDALPEFTVQMGNLRFSLGHVQ
YDGESPVAFPVAAQVGLGVGTSLLALGVIIIVLIYRRKSKQALRDYKKVQIQLENLESSV
RDRCKKEFTDLMTEMTDLTSDLLGSGIPFLDYKVYAERVFFPGYRESPLHRDLGVPDSRR
PTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDIL
RTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKH
QVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGDAQGIAVKVLDCDT
ISQAKEKMLDQLYKGVPLAQRPDSRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTL
QHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSEEPEPP
RPRRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILGTSRPVPLAVKYFFD
LLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTF
MDACTLADHKLGRDSPINKLLYARDIPRYKQMVERYYTDIRQTVPASDQEMNSVLAELSR
NYSGDLGARVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQVAAAVENKVTDL
Download sequence
Identical sequences A0A1U7QXA0
XP_005075031.2.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]