SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005076300.1.91757 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005076300.1.91757
Domain Number 1 Region: 10-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000785
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 
Domain Number 2 Region: 12-23,69-119
Classification Level Classification E-value
Superfamily EF-hand 0.00000703
Family Polcalcin 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005076300.1.91757
Sequence length 132
Comment PREDICTED: EF-hand calcium-binding domain-containing protein 10-like [Mesocricetus auratus]; AA=GCF_000349665.1; RF=representative genome; TAX=10036; STAX=10036; NAME=Mesocricetus auratus; AL=Scaffold; RT=Major
Sequence
MNPDGNRELQAKEYLEKHRIMELLNQLTSFLLFDRPKKPREYLISLLERLRIAKITGIAF
PFFMDNSNIVSMFEMMDSSGRGCISFMQYKEALKNLGLCAAGEVLNDDGHIITLDKFRDE
VNRRTEEIWSLF
Download sequence
Identical sequences A0A1U7QZE6
XP_005076300.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]