SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005112742.1.21191 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005112742.1.21191
Domain Number 1 Region: 14-277
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.36e-48
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 339-384
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000262
Family SOCS box-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005112742.1.21191
Sequence length 431
Comment PREDICTED: tankyrase-1-like [Aplysia californica]; AA=GCF_000002075.1; RF=representative genome; TAX=6500; STAX=6500; NAME=Aplysia californica; AL=Scaffold; RT=Major
Sequence
MSSKAVVNPALGEFFTAVRFSNCKKIKKMLKDRVVDVEDVDLSDSCRPTAIIVASELGLL
EVVKTLMRAKPKPADVNAETRKGRRAIWWAAKSSNLELAQLLVSEKKCEVNYVDKETGCT
PLYRAIISNCAPVARELVHAGADVNIRRLGFDIGAETPLIKSVQLNNLEICDLLVNSMCK
IHAKTEEGLTALHFSIAYRRYEICEYLLKSGIKVNACSNHGVTAMTVAIEQHNPYMVRLL
VQFGYKLNKPYKWSETPLEQAIKIHSQECALTLLHWGCSRKRKRKQTSYFYLAVNEKQWS
IVRFLTHLNPMYLQETWIRAAKWPVSIYHRPDAREYLLNAAKEVWTLKQYCRAVVFNTIG
KYAPVKIDKLPLPPVLKEYLKFNEFVKEDFYIQEPLEKVECPFDCPTICPQRNCPELDIS
ISSDTDSEFEI
Download sequence
Identical sequences XP_005112742.1.21191 XP_005112743.1.21191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]