SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005155317.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005155317.1.45394
Domain Number 1 Region: 198-364
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-40
Family Dual specificity phosphatase-like 0.0000119
Further Details:      
 
Domain Number 2 Region: 374-510
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.11e-32
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 3 Region: 57-191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000004
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005155317.1.45394
Sequence length 511
Comment phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MTSVHFNPGLDSKEVNGNSVKEEAEVQIDDGKEETKDPDTMYHQVRKKITPFVMSFGFRV
FGLVLIILDIIMVIVDLSLSEKSRDVGGALETVSLVISFFFLIDVLLRVYVEGFKVYFSS
KLNIVDACIVVITLVVTMIYAFSDFSGASLIPRVVTFLRSLRILILVRIFRLASQKRELE
KVTRRMVSENKRRYQKDGFDLDLTYVTERVIAMSFPSSGKQALYRNPIREVVRFLDTKHM
DHYKVFNLCSEKGYDPKFFHYRVERVMIDDHNVPSLDDMLRYTACVRDWMAADSRNVIAI
HCKGGKGRTGTMVCTWLIDSDQFESAQESLDYFGERRTDKSMSSKFQGVETPSQSRYVGY
YEIMKNQYNRQLPPRKSLKIKSIRIHSIAGVGKGNGSDLKLKIIVKHELVFQCVCAKQHN
CTVFPDTGSNAVVISLQDGPIVTGDVKVMFESSAGLPKGYEDCPFYFWFNTSFVENYRLF
LSREELDNPHKPKTWDIYKEDFGVTLSFTEP
Download sequence
Identical sequences F1QG29
ENSDARP00000074004 7955.ENSDARP00000074004 ENSDARP00000074004 XP_005155316.1.45394 XP_005155317.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]