SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005158134.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005158134.1.45394
Domain Number 1 Region: 138-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000133
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 1066-1115
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000494
Family PHD domain 0.008
Further Details:      
 
Domain Number 3 Region: 24-73
Classification Level Classification E-value
Superfamily RING/U-box 0.000000662
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Weak hits

Sequence:  XP_005158134.1.45394
Domain Number - Region: 88-130
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0641
Family B-box zinc-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005158134.1.45394
Sequence length 1293
Comment E3 ubiquitin-protein ligase TRIM33 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MFTAGPTGRSASPRPDLQKAVCGTCAACKGHLNDSTEPKLLPCLHTVCNTCLTKICTDGS
SQDCPSCAQSFGLSEVTECAIFEDLSDNNKAPKCGGCEENEVSGWCVQCEEALCLDCVTA
HHRVKVTRDHEVMPKKPPTGWIQRRRCPLHSQESLRFFCLVCEELTCKDCQLITHRGHSF
VNQEEAVESQKQQMNSLLDSIRRQKGTISHSLLLLEARLQDIEHVKMLTKKLLIQSVHKI
YHSMVLKASQILKDIQAVFAEEVRVLLERKSSLSRLEGCQDYIADFIDKIQRTQGHCLLV
YKKRIETQVKMLLSRETCTPESMIKLHIEIQKDLCQHILNFGFVRITKNFVPFTSERTQY
IQTNPVSVESLNPNSMETATNVGHAMASSSVNEQIPGDPATSSQTAPNHQILQSILQLSR
SNQATTQPQPNHGTLFQPDLSNVRYSDSQSSCSSSPLSVQAQSHEVMSGQSKHAYSPSVH
SQHHLPSSQQTKTKCNSKTAKRGNTWTLHYYSDMPNQTIPRIIQTPAPTHSIPASKKTPV
QTHPNPTNNQILTPVHPMLAHNQTTIPVYPIQGNNQIPIASNNQTSIPTHPIPGSNQPLL
LQQIPANTQSTLLTHAVLVNNLSPVVPYGLTANDQTLVQTQPILANNQTSVPTHAIPFNN
QRKPLPQPITDNNKSLVLTHPIPNNNQTPVLMPPIQANNQAATLTHSVQFNNQTPGLTHP
VSNIQSDVQTLIVAHPIQAGFLGAVHGFAAQPNVPLTILSTVNALPLNEVTAVSNVHSTG
TSNDVMNHCPINSAFNVTPSGSSPHANPLCSDPISGSNRTNIPVKALADSACDQEAGMSS
TSFTYADYSESNLPTSTVSDPRESSPLSPDLCFAVLDSLSTTTKKCVRQDKAGQSTTECD
SGSKHWSADMPTTFRQLLETTCTPVNSIDSRNATTPVGSTPCGSSEDITGKSVSNGKTIQ
SCFDHSEGEKNEKESAATLKRFKTQLKEFRRSLCVSLVRLPVSLPPHGHPLPEFHLTTDS
STDHILVQESQGGEIKQVWRWHDGPVASRASSCSTSQMSDIDSSPASDVQFCVVCQSAGA
SLLCAKCGSAFHSDCHIPPIFTKPREDWVCLLCQDVSETLMIDSGEEMKTTGLSLQDQRR
CEKLLLGLQCDENMGLLYSVTKNHSKTAEFDIILGRLQGNRKPPYRTAAELVSDVWTLFD
ILFIRSENKSLVVSLQQSFQQCLNQSFGTSLHASLLQHSSSTGAGETSQTDPLKQKHRNT
LKRMREFFTTKSTIAVKKSCNDKGKKDTTAAKH
Download sequence
Identical sequences E7FDQ1
ENSDARP00000106248 ENSDARP00000106248 XP_005158134.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]