SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005160158.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005160158.1.45394
Domain Number 1 Region: 41-286
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.98e-46
Family Protein kinases, catalytic subunit 0.0007
Further Details:      
 
Domain Number 2 Region: 442-611
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.83e-37
Family Ypt/Rab-GAP domain of gyp1p 0.0018
Further Details:      
 
Domain Number 3 Region: 589-701
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 
Domain Number 4 Region: 745-885
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000000406
Family Single-domain sulfurtransferase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005160158.1.45394
Sequence length 893
Comment TBC domain-containing protein kinase-like protein isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MQPLRDAELGASTFFASPLPHDVCGSNGLPLTPNSIKILGRFQILKTITHPRLCQYVDIS
RGKHERLVIVAEHYEKSLKDLLKQRKPVSPEKVLQVAYEVLEGLEFMNKHGMVHRALSPN
NVLLDRADKVKLAKFGLYHMTDHGADVDFPIGYPSYLPPEVIAQGCFYSSEPSINEAPQP
SGPKTDVWSLGVLLFELCVGRQILQNIDISERMKFIITLGCMDDIITVLAEEHGCIDTIK
DLPENVQALLRKCLTFLPSKRPTPSDLLGDAVFESISSEYTPYQSPVHLFSASPRCAYLQ
LPDDISELCRENGENYLSERAIDEVYHLWCLAGGDLEKELTNQEIIQSKPPICTLPKFIL
EDGESFGQGRDRSFLLDDTTVTLSLFQLRNRLKDVAGETYFPLLEDEQCSLPQSSSSNEL
SATVTLPLIIRERDTEYQLTRIVLFHRLLKAYPYKKNQIWKEARVDIPPLLRGLAWAALL
GVEGDIQSKYDSIDKDTPIPTDRQIEVDIPRCHQYDELLSSPQGHVKFRRVLKAWVVSHP
DLVYWQGLDSLCAPFLYLNFNNEALAYACMSAFIPKYLYNFFLKDNSHVIQEYLTVFSQM
IAFHDPELSNHLNEIGFIPDLYAIPWFLTMFTHVFPLHKIFHLWDTLLLGNSSFPFCIGV
AILQQLRDRLLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPNKPP
SESNSFGKTPSYYASEFQELTKTDLSREPLKLSELKAEVSPRISVEDLIDLCELSGPAFF
KTPVKRARTGKPKILAVDIRSLEDFSRGHIYGSINIPYTSTFGPEGELLQCPASSSLAGY
RLRVIVILSSVMKNAITFATHLVKVNFPRVCVLDGGMNKMKSTGLLTVPSPQI
Download sequence
Identical sequences E7F1V3
ENSDARP00000043308 NP_001074106.2.45394 XP_005160158.1.45394 7955.ENSDARP00000043308 ENSDARP00000043308 ENSDARP00000109057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]