SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005164874.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005164874.1.45394
Domain Number 1 Region: 179-193,351-587
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-59
Family Nuclear receptor ligand-binding domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 110-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-30
Family Nuclear receptor 0.000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005164874.1.45394
Sequence length 600
Comment nuclear receptor subfamily 2 group C member 1 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MEGESPRIQLVSADGGLQIVTEQQLAQKVQIVTAIDQAGAGKQQFILANLDYPNQEKLFI
KQENSPAKVILTSSDGSAVNQLLFASPELSGQQIQFVTDGSDQGSMKPPVEYCVVCGDKA
SGRHYGAVSCEGCKGFFKRSIRKNLVYTCRGSGECVINKHHRNRCQYCRLQRCMALGMKQ
DSVQCERKPVEVSREKPANCAPSIEKIYIRKNLCSPLAAMPTFVSQKESTRPTSLLDSNM
LLNIQQSISKLDNTILIPSSPDQNDSSQGDLGTLANVVTSLGHLNKSREMMDSSTDLSGI
DTMSNDDSVMTDIQREESNDVTRAFDTLTKVLKAEESCGEEVADGAVAVRDDEQTSALLE
LEGPLLSDMHVPFKLMMPLPMPDFLNLNYICESASRLLFLSMHWARSIPAFQALGSENGI
TLMKACWNELFALGLAQCSHIMNVETILTAIINHLQTSLDEEKLSPERVKQVMEHIWRMQ
EFCNSMSRMSPDAYEYAYLKAVVLFSPDHSAVDGTLQIERFQEKAYMELQDYVSKVYPED
TYRLSKLLVRLPALRLMSAAVTEELFFAGLIGNVQIDSIIPYILKMESTDYNSQPISGVE
Download sequence
Identical sequences Q5RH32
7955.ENSDARP00000066947 ENSDARP00000066947 ENSDARP00000066947 ENSDARP00000109984 XP_005164874.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]