SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005167044.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005167044.1.45394
Domain Number 1 Region: 253-516
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.78e-82
Family Nuclear receptor ligand-binding domain 0.00000000139
Further Details:      
 
Domain Number 2 Region: 149-232
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-26
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005167044.1.45394
Sequence length 517
Comment peroxisome proliferator-activated receptor delta isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MEQVEEPTSEMKCDGQVDGVMKSQSSLQTELSSVPILRDAAWLGAQEGESASSDCGGTSD
LQEPSSVSGEEVEGSETSDITGLEASPGSKGSWGGNQQNGDRTPQESPPPNSETPVTAGA
FSDPLQVPSLSLSDQLRLGREDPNKLGLNVECRICGDKASGFHYGVHACEGCKGFFRRTI
RMKLEYERCERACKVQKKSRNKCQYCRFQKCLALGMSHDAIRYGRMPEAEKKKLVAGLLA
GENPQSSSGADLKTLAKHVNTAYLRNLNMTKKKARSILTGKTSCTAPFVIHDMDSLWQAE
NGLVWNQLNGAPLNKEIGVHVFYRCQCTTVETVRELTEFAKNIPGFVDLFLNDQVTLLKY
GVHEAIFAMLPSLMNKDGLLVANGKGFVTREFLRSLRKPFSEIMEPKFEFAVKFNALELD
DSDLALFVAAIILCGDRPGLMNVKQVEQIQDGILQALDQHLQVHHPDSSHLFPKLLQKMA
DLRQLVTENAQLVQMIKKTESETSLHPLLQEIYKDMY
Download sequence
Identical sequences A9C4A5
NP_571543.1.45394 XP_005167044.1.45394 XP_009302202.1.45394 XP_009302203.1.45394 ENSDARP00000110137 7955.ENSDARP00000023084 ENSDARP00000110137 ENSDARP00000120571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]