SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005167234.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005167234.1.45394
Domain Number 1 Region: 1026-1130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-32
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Weak hits

Sequence:  XP_005167234.1.45394
Domain Number - Region: 571-782
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0238
Family HBL-like 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005167234.1.45394
Sequence length 1132
Comment cytospin-A isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MKKAGRPVGNKAASGGGKGDSVTAGNCAGKNTVKSPTSAPLSKVKSNDDLLAAMAGSSAG
TNNSVAKGKKSTSTHSTSCGTNTNNPDTKTKTTSGPSGKRTTSMTSKESNSSRERLRNSR
NSSSKKQSSTGASDRAQPKHSRALAQTSDSESRMSKSKSDGQLSDKVALEAKVKNLLGLA
KSKDVEILQLRGELRDMRVQLGLPEEDEEEERPPEREAAAVITAADVESTLLLLQEQNQA
IRGELNLLKNENRMLKDRLNALGFSLEQRLDGADKTFGFPSTSPELSSGGAGAHGDCATV
ASSVEGSAPGSMEDLLTGGQRSGSTDNLDSESSEVYQAVTSSDDALDAPSGCGSSSSSES
EGGPPACRSSSRKGSSGNTSEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQ
ELNGENERLGEEKVLLMDSLCQQSDKLEHCGRQIEYFRSLLDEHGVAYSVDEDIKSGRYM
ELEQRYVELAENARFEREQLLGVQQHLSNTLKMAEQDNAEAQNVIAALKERNHHMERLLD
VERQERASMAAVLEECKAAVNNDQAELSRCRVLLEQERQKVAELYSIHNAGDKSDIHQLL
EGVRLDKEEAEAKASKLQDDLGHARSEVACLQDTLNKLDAEYRDFQSVVQKELAEQKRAI
EKQREDLQEKETEIGDMKETIFELEDEVEQHRAVKLHDNLIISDLENSMKKLQDQKHDME
REIKILHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLRRRLQEAQEKNEKLG
KEIEEVKNRKQDEERGRVYNYMNAVERDLAALRQGMGLSRRPSTSSEPSPTVKTLIKSFD
SASQGPGANATAVAAAAAAAAAAAAVTVTSTTPTAPLPRTPLSPSPMKTPPAAAVSPIQR
HSITGSMAAAKPLSSLADKRPSYTDISMPAEHLLRAANSRPASALQRVSNMDTSKTITVS
RRSSEEPKRDISTPDGGPASSLISMSSAAALSSSSSPTASVNPTARSRLREERKDPLSAL
AREYGGSKRNALLRWCQKKTEGYQNIDITNFSSSWNDGLAFCAVLHTYLPAHIPYQELNS
QDKRRNFTLAFQAAESVGIKSTLDITDMVHTERPDWQSVMTYVTSIYKYFET
Download sequence
Identical sequences Q2KN93
ENSDARP00000010292 ENSDARP00000010292 7955.ENSDARP00000010292 XP_005167234.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]