SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005174316.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005174316.1.45394
Domain Number 1 Region: 7-301
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.7e-58
Family BAR domain 0.000000188
Further Details:      
 
Domain Number 2 Region: 471-615
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-24
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 
Domain Number 3 Region: 278-372
Classification Level Classification E-value
Superfamily PH domain-like 5.39e-22
Family Pleckstrin-homology domain (PH domain) 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005174316.1.45394
Sequence length 662
Comment DCC-interacting protein 13-beta isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MPAVHHKLLLEEALQDSPQTRSLLSVFEEDAGTLTNYTNQLLQSMQRVFGAQNEMALATE
QLSKQLLEYEKQNFALAKGDEEVINTLQQFAKSVEELNALHSELSTQIADKMVFPMVQFR
EKDLTEISTLKEIFSIATDEHEAAMVKYSRLPKKRENEKVKAEVVREVAYSRRKQHQAAM
QYYCALNALQYRKRVAMLEPMLGYTHAQINFFKKGMELVSKKLDSFLNSVSNMNESIESQ
LEIDAEVMRSSQRELLSVDDSVYMPDHDQAAVSRALIQKAGYLNIRNKTGLVTTAWDRLF
FFTQGGNLMCQPRGAVAGGMVLDLDNSSVMAVDCEDRRYCFQITSPNGKTSLILQAESKR
EYEEWICTLNNISRQIYLTDNPEAVAIKLHQTALQAVTPITSFEKRAEGSPNPDRAKPGG
LPVTSQEAEKSSVSLEPEDLIVPGTPIQFDIMLPASEFLDQNRAGARRTNPFGETEEDDD
ESDTHDSLLQQVFAVRFLGSMAVRSGHTQEVIYEAMRQVLAARAIHNIFKTTESHLMISS
SCIRLIDPQTQVTKISFQLQDVSEFAAHQENERLMGFVVRSSAEDDEPSFSVFVFESNTE
GEKICYTINLAKEIADARKDPEALAQLMKSMPLTNDGKFLLLDNETGDTAETAGQEEQES
EA
Download sequence
Identical sequences F1RB27
XP_005174316.1.45394 ENSDARP00000101503 ENSDARP00000101503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]