SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005176096.1.65292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005176096.1.65292
Domain Number 1 Region: 128-577
Classification Level Classification E-value
Superfamily Sema domain 7.19e-129
Family Sema domain 0.0000791
Further Details:      
 
Domain Number 2 Region: 1462-1591,1800-1954
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.68e-43
Family p120GAP domain-like 0.047
Further Details:      
 
Domain Number 3 Region: 939-1036
Classification Level Classification E-value
Superfamily E set domains 0.000000000000074
Family Other IPT/TIG domains 0.0084
Further Details:      
 
Domain Number 4 Region: 1033-1121
Classification Level Classification E-value
Superfamily E set domains 0.0000000000011
Family Other IPT/TIG domains 0.094
Further Details:      
 
Domain Number 5 Region: 580-631
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000275
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 1141-1198
Classification Level Classification E-value
Superfamily E set domains 0.00000000636
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005176096.1.65292
Sequence length 2018
Comment PREDICTED: plexin-A4 [Musca domestica]; AA=GCF_000371365.1; RF=representative genome; TAX=7370; STAX=7370; NAME=Musca domestica; strain=aabys; AL=Scaffold; RT=Major
Sequence
MKFAYLSCRIIVILALLAHHVTTSIETYNEVVSSTVGKSKSLPQSPASVGASSSIIELFS
SAAYKGFESAALTYEDPNNTSSPSSSNQSLSFNLENKTNNNGDSSSAPSDLLSGAESSNK
TVNNFITKKVHFDTQLNHLVVDTVTGRVYVGGVNNLYQLSPDLEIHESVKTGPKNDSVEC
SILDCPAHAKRKPTDNYNKVLLIDRATSRLIVCGSLFQGNCTVHNLQNVSIIEQEVQDAV
VANDANSSTVAFIAPGPPQHPLTNVMYVGVTYTNNSPYRSEIPAVASRSLEKKNMFQIAS
AAVTTGTRTFINSYAREGYLVTYVYGFSSEKFSYFLTTQLKRNHHVYPKEYITKLVRICQ
EDSNYYSYTEIPVECSSGTKYNLVQAAYLDKPSADLAESLSVTPQDDVLYAVFSEGRGNQ
STDNSALCIYSLKSIRQKFMQNIKSCFNGNGFRGLDFISPDMRCVPTKLQTIGEDFCGLD
VNSPLGGDQPITAVAVLKFKDYLTSIAATSSSGYTVVFIGTGNGYLKKIVVESSTVANEY
AEIPISVGSPILKDMLFDNQNMHLYVMSRSQVAKVKVYDCSGYKTCGECLGAHDPYCGWC
SLENKCSSRSTCQDDVNDPLYWINYKTGKCTTITSVMPHQLQRTTARTLELIIDHLPQLK
ENLVCAFTTEEKALFTNATKKRNGVNCTTPRTDMLPQIGQGKHHFTAKLSVRTRNGPDLV
STDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPSYRS
GPGFCPTINATGDGSEILVAAGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLNAQL
LGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHDIHVVIYRCRDMADSCGMCLA
LAQKYNCGWCSSTNTCEVEEQCNKNNNEGKTDWLNRMETCPNPEIHYFSPKTGPWEGGTN
ITIRGINLGKKFSDIYSGVRIAGINCSPFEKFYVDTKEIVCIVDSPGEQMYRSGRIVVQI
GDYRGESKEDYEFVDPKISSFSPRHGPVSGGTQIRIIGKYLNSGSRIQAFINDHLPCEIL
SVDENQAICSTSSSPGIIEGRLKMVFDNGPREFNEYNFKYVLDPTVEQVYSGTPGGQIKV
PKGIPAGGTEITVIGTHFNFIQAPSMYVIYKNKTFLSQCQVKSSTEMICDSPTVETSADD
MLEAENPQKLEYGFLMDHVLQVQNLSAKHQNYYELYPNPVYYNFEERVKYYKSEYLTING
RHLDRACSESDVKVFIGKKLCNITSLSRQQLTCRPPLEPFGGDNYDSDDDSGPESKDSSG
PEVVVRIGRSLEYRIGVLSYASPNIMDDLGKNAFVVVVSGVILLLLIFVALLVAYKKKTS
ESNRVLRNMQEQMDILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYCTYAMKIL
FPNHEDHIVLQWERPELLRKENGLRLFGKLIMNKTFLLLFIRTLESNRYFSMRERVNVAS
LIMVTLQSKLEYCTDILKTLLSDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYK
FLKECAGEPLYMLFRAVKGQVDKGPVDACTYEARYSLSEEKLIRQLIDFRPMTVYASIIQ
QPIFCNNVEMLPTHTENVPVKVLDCDTIGQVKEKCLDTIYRNIPASQKPRKDDLDLEWRT
GATGRVILYDEDTTSKTENEWKKLNTLQHYNVPDGAALSLVPKQSSIYNFSILSDKNEKS
HKYETLNLSKFTSSSPTFSRAGSPLNNDIHENGIKYWHLVKHHDNDVQKEGERVNKLVSE
IYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQALLHGITDPEVV
HTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPS
SKLLYAKDIPEYRKWVDRYYHDIREMPPISDQDMNAMLAEESRLHTSEFNTNCALHELYT
YVVKYNEQLAVTLEEDEFSQKQRLAYKLEQVHNIMSAE
Download sequence
Identical sequences A0A1I8MLF1
XP_005176096.1.65292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]