SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005182408.1.65292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005182408.1.65292
Domain Number 1 Region: 403-620
Classification Level Classification E-value
Superfamily Bet v1-like 1.98e-29
Family STAR domain 0.012
Further Details:      
 
Domain Number 2 Region: 54-168
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-24
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 
Weak hits

Sequence:  XP_005182408.1.65292
Domain Number - Region: 268-309
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0131
Family Sec2 N-terminal region 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005182408.1.65292
Sequence length 631
Comment PREDICTED: collagen type IV alpha-3-binding protein [Musca domestica]; AA=GCF_000371365.1; RF=representative genome; TAX=7370; STAX=7370; NAME=Musca domestica; strain=aabys; AL=Scaffold; RT=Major
Sequence
MNYANQLNGGSSSGISAPPQTVVTTATINNNNTTATSSPALAAANMVLNDPPSSDSEPEF
IDNSSVELRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLSRATIKP
HESDELRFDVVVNNYNNWCLRADTPEDRMHWVEVLRMYKEDSTSTDTTSLRRHGSTMSLQ
SNTVSVASGSSLKKTQRNLKEKVGEIETFKDILFGQIETLQRYFDACADVNKGMDKPLDL
GDGLKAIDFKGESITFRATTAGVLTTLQHCLEIIVENDETWKKKLDREIEKRKKVEEQNR
KLKEEIEKLKRISYPGPDLEEGPHSTLPEDEFFDAVETGLDKIEEDMQLRVKLKLQSQQS
QISTHNSVNASATENGENDDVDAEFGTGALARSHDLWEEIDRVCLEQLHYARQGVGQDGN
GWQIFADEGEIKMYKREEEVNGMVVDPLKAYHSVKGVTAREMCHYFFMPEFRNEWETTLE
DCTILEKISPDTYLFLQTHKRVWPASQRDALFWSHMRKITDGLDEGAVDTWIVCNNSTNY
STQESKNGKCVRIFLTVIMACQTHLPPGKTKADKLTRDDLTCKVTYCSVVNPGGWAPASA
LRAIYKREYPKFLKRFTSYVIDQRKDQPIMF
Download sequence
Identical sequences T1PMQ2
XP_005182408.1.65292 XP_005182409.1.65292 XP_011292040.1.65292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]