SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005202022.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005202022.1.76553
Domain Number 1 Region: 13-171
Classification Level Classification E-value
Superfamily Nudix 8.12e-20
Family MutT-like 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005202022.1.76553
Sequence length 195
Comment PREDICTED: U8 snoRNA-decapping enzyme isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MAGMRRLELSEALHLGPGWRHACHALLYAPDPGLLFGRIPLRYAVLMQMRFDGRLGFPGG
FVDLRDGSLEDGLNRELGEELGEAAGAFRVERADYRSSHAGSRPRVVAHFYTKLLTLEQL
TAVEMGAPRARDHGLEVLGLVRVPLYTLRDGVGGLPAFLENTFIGNAREQLLEAVQNLGL
LEPGSFARLKISTPP
Download sequence
Identical sequences A1A4Q9
XP_005202022.1.76553 ENSBTAP00000049112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]