SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005203785.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005203785.1.76553
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily EF-hand 6.41e-23
Family S100 proteins 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005203785.1.76553
Sequence length 156
Comment PREDICTED: protein S100-A9 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEDKMSQMESSIETIINIFHQYSVRLGHYDTLIQKEFKQLVQKELPNFLKKQKKNEAAIN
EIMEDLDTNVDKQLSFEEFIMLVARLTVASHEEMHNTAPPGPGHRHGPGYGKGGSGSCSG
QGSPDQGSHDQGSHGHGHGHSHGGHGHSHGGHGHSH
Download sequence
Identical sequences F1MHS5
ENSBTAP00000044096 ENSBTAP00000008523 XP_005203785.1.76553 XP_005203786.1.76553 XP_005203787.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]