SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005208310.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005208310.1.76553
Domain Number 1 Region: 30-59
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000904
Family C2HC finger 0.0013
Further Details:      
 
Domain Number 2 Region: 1-27
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000452
Family C2HC finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005208310.1.76553
Sequence length 382
Comment PREDICTED: cell growth-regulating nucleolar protein isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MVFFTCNACGESVKKVQVEKHVALCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGG
KGYEGKTHKGDVKQQAWIQKIHELIKRPNVSPKVRELLEQISGFDNVPRKRAKFQNWMKN
SLKVHNESILEQVWNIFSEASSSEPVGKGPDQQPPEPVTKPCAENNADVPSSKANSSTEE
PAEAKKNKRERKAERQKNTKKEKKELRLENHQEDAKSQKPKKRKAAQEAEQEAADGSSGT
KSQRKKSKAERAQDGAVDGGAKVGEQADAGPGKRKRKHSEVEANSKKKKIKPPENSEDGE
PENHEAPAKGKFNWKGTIKAVLKQAPDNEITIKKLRKKVLAQYYAVTNEHHKSEEELLVI
FNKKISKNPTLKLLKDKVKLVK
Download sequence
Identical sequences Q58DA3
NP_001026939.1.59421 NP_001026939.1.76553 XP_005208310.1.76553 XP_019818651.1.53367 ENSBTAP00000004763 9913.ENSBTAP00000004763 ENSBTAP00000042247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]