SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005208822.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005208822.1.76553
Domain Number 1 Region: 89-260
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.41e-45
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 
Domain Number 2 Region: 238-356
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005208822.1.76553
Sequence length 807
Comment PREDICTED: EVI5-like protein isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MASPTLSPDSSSQEALSAPTCSPTSDSENLSPDELELLAKLEEQNRLLEADSKSMRSMNG
SRRNSGSSLVSSSSASSNLSHLEEDTWILWGRIANEWEEWRRRKEKLLKELIRKGIPHHF
RAIVWQLLCSATDMPVKNQYSELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLGQEVLF
NVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELG
LCIYQFEYMLQEQLPDLNTHFRSQSFHTSMYASSWFLTLFLTTFPLPVATRVFDIFMYEG
LEIIFRVGLALLQVNQTELMQLDMEGMSQYFQRVIPHQFDSCPDKLILKAYQVKYNPKKM
KRLEKEYAAMKSKEMEEQIEIKRLRTENRLLKQRIETLEKESAALADRLIQGQVTRAQEA
EENYVIKRELAVVRQQCSSAAEDLQKAQSTIRQLQEQQDNPRLTEDFVAHLETELEQSRL
RETETLGALREMQDKVLDMEKRNNSLPDENNVARLQEELKALKVREGEAVASARELKLQL
QELSDTWQAHLSRGGRWKESPRKLVLGELQDELMSVRLREAQALAEGRELRQRVVELETQ
DHIHRNLLNRVEAERAALQEKLQYLAAQNKGLQTQLSESRRKQAEAECKSKEEVMAVRLR
EADSMAAVAEMRQRIAELEIQREEGRIQGQLNHSDSSQYIRELKDQIEELKAEVRLLKGP
PPFEDPLAFDGLGLARHLDEDSLPSSDEELLGVGVGVGAALQDALYPLSPRDARFFRRLE
RPAKDSEGSSDSDADELAAPYSQGLDN
Download sequence
Identical sequences A5PK17
ENSBTAP00000049706 NP_001092545.1.59421 NP_001092545.1.76553 XP_005208822.1.76553 ENSBTAP00000049706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]