SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005215735.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005215735.1.76553
Domain Number 1 Region: 497-527,565-631
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000104
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005215735.1.76553
Sequence length 655
Comment PREDICTED: anion exchange transporter isoform X2 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MTGAKRKKKSLPWSKMRIPRCEDFKQWCRRRLPILEWATHYSLKESLLPDTVSGMMLAVQ
QVAQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERLVP
LSSQNLTTHSNTSVLGLSDFEMQRIGVAAAVSFLGGVIQVAMFVLQLGSATFLITEPVVS
AMTTGAATHVVTSQAKYLLGMKMPHISGPLGFFYIYAYIFKNIKSVQLEALLLSLLSIVV
LVLVKELNEQFKRKIKIVLPVDLVLMIAASFTCYCTDMENTYGLEVVGHIPKGIPPPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFRYSVDDNQEFLAHGLSNVIASFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYTIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKRYWNVDKIDWGIWVSTYIFTICFAANVGLLFGVVCTTAIVIGRFPRAKTLST
KNMKEMEFKVKTEMDDETLQQVKIISINNPLVFLNAKKFHNDIMNIIQKENIGNQPLDEI
RKYEQSTLVSSLSGVCNEEATQPCLNPKCSLVLDCSGLTFSDYTGVSMLVEVYMDCKNKS
VDVSLVHCTASLIKAMKYCGNLDSEKPIFFESVSAAISNIHLNKNLSILSDHSEI
Download sequence
Identical sequences E1BD54
ENSBTAP00000043158 ENSBTAP00000043158 NP_001180075.1.59421 NP_001180075.1.76553 XP_005215735.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]