SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005216299.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005216299.1.76553
Domain Number 1 Region: 97-281,378-423
Classification Level Classification E-value
Superfamily L domain-like 1.28e-24
Family Ngr ectodomain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005216299.1.76553
Sequence length 798
Comment PREDICTED: X-ray radiation resistance-associated protein 1 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MASAELYKLDDGKPHLSNCFPAKNLLRTPEEAGRGHWLVARKGGLKKKPKNVAETTAEGQ
EGQKVSFEVEGKKGSRQENQVDTPGHMLDLAFLLKHHCVKDPSDLCSINVSGLKFSKAKE
KDFKHFNSVIYINASENLLPLEAFHTFPVLKELELAFNGIKTVYVKYGDFKSLEFLDLSF
NSLTAEAICDLGILPHLRVLLLTGNGLTSLPPSLAVAEQEASVTSLTTKRYILRFPALET
LMLDDNKLSNPNCFVSLAGLKRLKKLSLDQNRIFRIPYLQQVQLRDGSGDWVGGRGSPRK
QPQSMLQSKSWIYEASDDQPDYTILPMKKDVDRTEVVFSSYPGFSTSETTKVCALPPIFE
ILPVKSLKARNQTLAPPFPELRYLSLAYNKIAKEDAILPVALFPSLCELIFHNNPLVAHT
RGVPPLLKSFLQERLGIHLIRRKIVKAKHHILMPRKDSRKVKTQVPKVPKQPMILPHPSV
MIKSPSKEMLESEAELTMEPPPTKTISVEREMPIEGLGGPPMPHRTFVPLPPICSDSTVH
SEETSPRSDAAGRLSADQLSDEDTKSTESIFLTQVSGLSSSIFQRDDSEIKEKEQRPPST
APREAKRTQKKPPSASFPRKYHGYEELLTAKPDPTFVEPKGIQKNAQALQHMLKHPLVYR
SSKPRLDTLQKHYVPKEKRTRRIPVPPRRKTRAQLLDDILIRMRDTQNITEAPLGAVLRQ
RTEQRLVNQKQFLEAKKLLKEFRARYRRLVRCSLRSVFGTTAPPQARPALSGSQPKLGRF
LEFMDEFYQEPTASDLKG
Download sequence
Identical sequences E1BMB0
XP_005216299.1.76553 ENSBTAP00000053271 ENSBTAP00000008701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]