SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005216715.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005216715.1.76553
Domain Number 1 Region: 114-313
Classification Level Classification E-value
Superfamily L domain-like 1.02e-29
Family Ngr ectodomain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005216715.1.76553
Sequence length 321
Comment PREDICTED: opticin isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MKLLALLSLLILMLQEARTASLSEEREGDPYAILHLGDYVLSLDNYDEVIDPSNYDELID
YGDQLPQVKGTSLASLTRTRFTQSTEAARTLPSNPTTARPPTLGLLAAPANHGLPTCLIC
VCLGSSVYCDDADLENIPPLPQTTAYLYARFNRISHIRAGDFKGLTKLKRIDLSGNSISS
IDDKALRLLPALRDLILPENKLVALPTLPTSIEVLDVRMNRLQSSGIQPEAFRALEKLQF
LYLADNLLDAIPPSLPLSLRSLHLQNNMIETMQRDAFCDAEEHRHTRRPLEDIRLDGNPI
NLSLFPSAYFCLPRLPTGRFV
Download sequence
Identical sequences P58874
ENSBTAP00000018286 NP_991339.1.59421 NP_991339.1.76553 XP_005216715.1.76553 ENSBTAP00000018286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]