SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005217418.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005217418.1.76553
Domain Number 1 Region: 888-1186
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.62e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000987
Further Details:      
 
Domain Number 2 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-31
Family Third domain of FERM 0.0067
Further Details:      
 
Domain Number 3 Region: 105-212
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-27
Family Second domain of FERM 0.00046
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-20
Family First domain of FERM 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005217418.1.76553
Sequence length 1190
Comment PREDICTED: tyrosine-protein phosphatase non-receptor type 14 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSSVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCSLEQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQERKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNSVHLGIFFMGIF
VRNRIGRQAVIYRWNDMGNITHNKSTILVELVNKEETALFHTEDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCGEHYSETHTSQDSIFH
GNEEALYCNSHNSLDLSYLNGTVTNGGSVCSVHSVNSLSCSQSFIQASPVSSNLSIPGSD
IMRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGVVHTDSQSQSLRNLNIINTHAYNQ
PEDLVYSQPEMRERHPYTIPYGPQGGYGNKLVSPSDQLNPTNPTVPSKPGGPSAISHTVS
TPELANMQLQGAHSYNAAHVLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLV
TRKVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGAVHKRHSLEAMSSMVRGMEAMTL
KSLNIPMARRSTLREPGPPEEGPGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEEA
PDPVPQIPVLREKVEYSTQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQACLPPAVAR
ARLLRHGPAKAISVSRADQLAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLE
DSIIEREMMIRNLEKQKMACLEAQKRPLMLATLNGLSVARGSGREESRVDATRVPMDERF
RTLKKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKE
NNTGYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGANVIAMVTAEEEGGRT
KSHRYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDW
PDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTRNLRPPIVVHCSAGVGRTGVVILSELM
IYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences E1BEZ8
ENSBTAP00000028717 XP_005217418.1.76553 ENSBTAP00000028717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]