SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005219402.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005219402.1.76553
Domain Number 1 Region: 111-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000114
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  XP_005219402.1.76553
Domain Number - Region: 70-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000263
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number - Region: 33-64
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.0196
Family Expressed protein At2g23090/F21P24.15 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005219402.1.76553
Sequence length 170
Comment PREDICTED: zinc finger protein 576 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEDRHSKQTMEQQDSSKERSSRSPGGDICHLGALQCTRCLITFADSKFQERHMKREHPAD
FVAQKLQGVLFICFTCARSFPSSKALITHQRGHGPVARPSQPAAPITTPPTFPCPDCGKT
FGQAASLRRHRQAHEARTLPGPFACTECGQDFAQEAGLHQHYIRHARGEL
Download sequence
Identical sequences Q0VCI4
NP_001069901.1.59421 NP_001069901.1.76553 XP_005219402.1.76553 XP_019834919.1.53367 9913.ENSBTAP00000041328 ENSBTAP00000041328 ENSBTAP00000041328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]