SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005220643.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005220643.1.76553
Domain Number 1 Region: 540-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000157
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Domain Number 2 Region: 572-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000148
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 506-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000515
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005220643.1.76553
Sequence length 613
Comment PREDICTED: transcription factor Sp2 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MSDPQTSMAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVEAAVTPPAPP
QPTPRKLVPIKPAPLPLSPSKNSFGILSSKGNILQIQGSQLSTSYPGGQLVFAIQNPTVV
NKGTRSNTSIQYQAVPQIQASSPQTIQVQPSLTNQIQIIPGTNQAIITPSPSSHKPVPIK
PAPVQKSSTTTTPAQSGANVVKLTGGGGNVTLTLPVNNLVNTSDPGAATQLLTESPPAPL
SKTNKKARKKSLPAAQPPVAVAEQVETVLIETTADNIIQAGNNLLIVQSPGGGQPAVVQQ
VQVVPPKAEQQQVVQIPQQALRVVQAASATLPTVPQKPSQNFQIQAAEPSPTQVYIRTPS
GEVQTVLVQDSPPATAATASTTTCSSPASRAAHLSGTSKKHSAAILRKERPLPKIAPAGS
IISLNAAQLAAAAQAMQTININGVQVQGVPVTITNTGGQQQLTVQNVSGNNLTISGLSPT
QIQLQMEQALAGETQPGEKRRRMACTCPNCKDGDKRSGEQGKKKHVCHIPDCGKTFRKTS
LLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHARTHTGDKRFECAQCQKRFMRSDHL
TKHYKTHLVTKNL
Download sequence
Identical sequences Q5E9U0
9913.ENSBTAP00000018253 ENSBTAP00000018253 ENSBTAP00000054632 ENSBTAP00000018253 NP_001015654.1.59421 NP_001015654.1.76553 XP_005220643.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]