SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005225240.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005225240.1.76553
Domain Number 1 Region: 66-173
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 479-582
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 3 Region: 353-457
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000082
Further Details:      
 
Domain Number 4 Region: 198-300
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005225240.1.76553
Sequence length 583
Comment PREDICTED: scavenger receptor cysteine-rich domain-containing group B protein isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MGPLERPPIGWTHKEAEMHTGPQPDERSRGRGSGDRSTAPPPLPPALSFLLLLPLAGALQ
PTSLPFPELRLVGGPSRCRGRLEVLHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPR
PLAFGQGRGPILLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPTRR
VLTSREPPTTPQNGKGEGSVRLVGGAGPCQGRVEILHGGLWGTVCDDDWGLPDAAVVCRQ
LGCGAALAATTNAFFGYGTGHILLDNVHCEGGEPRLAACLSLGWGVHNCGHHEDAGALCA
VLGHSTLTALPPSATRVDWAWHTEPEATGVGALPSREPARLTTAAWAAGKKSGRLRLVGG
PGPCRGRVEVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLD
NVGCAGTEARLSDCFHLGWGQHNCGHHEDAGAICSGPDELVQQDGAETTRVPTPRPRDGH
LRLANGAHRCEGRVELFLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALEAPGEAHFGPGR
GPILLDNVKCRGDESALLLCSHIRWDAHNCDHSEDASVLCQPE
Download sequence
Identical sequences F1MCI4
ENSBTAP00000003928 ENSBTAP00000003928 XP_005225240.1.76553 XP_010817886.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]