SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005226046.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005226046.1.76553
Domain Number 1 Region: 354-503
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000163
Family Calmodulin-like 0.065
Further Details:      
 
Domain Number 2 Region: 188-281,335-369
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000574
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005226046.1.76553
Sequence length 533
Comment PREDICTED: calcium uptake protein 3, mitochondrial isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MAALRRLLWPPPRLPPPCSPHHPAHGPWGRPAGTAPGPPGRPFSCREEDEGAVAEAAWRR
RRRWRELSFAAAAGGGLVGLVCYQLYGDPRADSARAAGPWLPSDSAAAEPEDPPGGGGLF
PIPVAAAKETVAVGRTEVEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEP
KIAKTWKSLSKQELNQMLSETPPVWKGSSKLFRNLKEKGVISYTEYLFLLCILTKPHAGF
RIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKRETKGDEEKRAMLRLQLYGYHSPTNSV
LKTDAEELVSRSYWDTLRRNTSQALFSDFAERADDITNLVTDTTLLVHFFGKKGKAELNF
EDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPE
EKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKLSPHLVNT
VFKIFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR
Download sequence
Identical sequences F1MHU1
ENSBTAP00000039694 ENSBTAP00000039694 XP_005226046.1.76553 XP_005226047.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]