SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005226533.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005226533.1.76553
Domain Number 1 Region: 36-203
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.81e-42
Family Dual specificity phosphatase-like 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005226533.1.76553
Sequence length 219
Comment PREDICTED: dual specificity phosphatase DUPD1 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MTSGESKTGLKNVYPSAKKLLPKVEEGEAEDYCTPGAFELERLFWKGSPQYTHVNEVWPK
LYIGDETTALDRYGLQKAGFTHVLNAAHGRWNVDTGPDYYRDMAIEYHGVEADDLPSFDL
SVFFYPAAAFIDAALRYDHNKILVHCVMGRSRSATLVLAYLMIHRNMTLVDAIQQVAKNR
CVLPNRGFLKQLRELDRQLVQQRRQAQQGEDAEKCEQEP
Download sequence
Identical sequences P0C591
ENSBTAP00000003800 9913.ENSBTAP00000003800 XP_005226533.1.76553 XP_019809368.1.53367 ENSBTAP00000003800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]