SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005252058.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005252058.1.92137
Domain Number 1 Region: 533-821
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-85
Family Protein kinases, catalytic subunit 0.000000137
Further Details:      
 
Domain Number 2 Region: 66-166
Classification Level Classification E-value
Superfamily L domain-like 6.05e-16
Family Ngr ectodomain-like 0.00042
Further Details:      
 
Domain Number 3 Region: 203-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000199
Family I set domains 0.039
Further Details:      
 
Domain Number 4 Region: 283-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000303
Family I set domains 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005252058.1.92137
Sequence length 838
Comment PREDICTED: BDNF/NT-3 growth factors receptor isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQG
VGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQL
KPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKD
FHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNP
PTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYST
DYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIE
CITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Download sequence
Identical sequences A0A024R230 A0A2I3SK22 H2PSJ2
gi|21361306|ref|NP_006171.2| ENSPTRP00000036008 ENSP00000314586 ENSPPYP00000021662 ENSP00000277120 ENSP00000365387 ENSP00000277120 ENSP00000365387 9598.ENSPTRP00000036008 9600.ENSPPYP00000021662 9606.ENSP00000277120 ENSPPYP00000021662 NP_006171.2.87134 NP_006171.2.92137 XP_001135326.1.37143 XP_005252058.1.92137 XP_005252060.1.92137 XP_005252061.1.92137 XP_008959616.1.60992 XP_016816537.1.37143 XP_016870240.1.92137 ENSPTRP00000036008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]