SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005264485.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005264485.1.92137
Domain Number 1 Region: 405-717
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-92
Family Protein kinases, catalytic subunit 0.00000000953
Further Details:      
 
Domain Number 2 Region: 3-132
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.65e-29
Family PLC-like (P variant) 0.000000481
Further Details:      
 
Domain Number 3 Region: 236-295
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.73e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00039
Further Details:      
 
Domain Number 4 Region: 148-221
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.23e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005264485.1.92137
Sequence length 737
Comment PREDICTED: protein kinase C epsilon type isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP
Download sequence
Identical sequences G1S4U2 G3R8H1 H2P6C3 K7CBH8 L7RTI5 Q02156
ENSP00000378341 NP_005391.1.87134 NP_005391.1.92137 XP_002812114.1.23681 XP_003262853.1.23891 XP_003309040.2.37143 XP_003822705.1.60992 XP_004029222.1.27298 XP_005264485.1.92137 XP_016803947.1.37143 9600.ENSPPYP00000013897 9606.ENSP00000306124 gi|4885563|ref|NP_005391.1| ENSNLEP00000020530 ENSPPYP00000013897 ENSP00000306124 ENSP00000306124 ENSNLEP00000020530 ENSPPYP00000013897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]