SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005325323.1.77405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005325323.1.77405
Domain Number 1 Region: 72-119
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000562
Family Elafin-like 0.00045
Further Details:      
 
Domain Number 2 Region: 29-72
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000275
Family Elafin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005325323.1.77405
Sequence length 121
Comment WAP four-disulfide core domain protein 2 [Ictidomys tridecemlineatus]; AA=GCF_000236235.1; RF=representative genome; TAX=43179; STAX=43179; NAME=Ictidomys tridecemlineatus; AL=Scaffold; RT=Major
Sequence
MPVPRLCALAAALLLGLLLLGLPPATGAGERAGVCPQLPADVNCTKECLSDSDCADYRKC
CHAGCGTVCSIPNEKPGSCPNVDLPQLGICQDQCQEDSQCTGPMKCCRNGCGKVSCVTPD
P
Download sequence
Identical sequences I3MWX4
ENSSTOP00000016619 XP_005325323.1.77405 ENSSTOP00000016619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]