SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005326512.1.77405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005326512.1.77405
Domain Number 1 Region: 56-194
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000594
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005326512.1.77405
Sequence length 217
Comment PTB-containing, cubilin and LRP1-interacting protein isoform X1 [Ictidomys tridecemlineatus]; AA=GCF_000236235.1; RF=representative genome; TAX=43179; STAX=43179; NAME=Ictidomys tridecemlineatus; AL=Scaffold; RT=Major
Sequence
MWQPATERLQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKARTHSGCKV
TYLGKVSTSGMQFLSGCTEKPVIELWKKHTLAREDVSPANALLEIRPFQVWLHHLDHKGE
ATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAH
AMMEAFKKTFHSMKSDGRIHRDSSSEEVSQELESDDG
Download sequence
Identical sequences I3MJT9
ENSSTOP00000011472 XP_005326512.1.77405 ENSSTOP00000011472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]