SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005328788.1.77405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005328788.1.77405
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 2.17e-55
Family C-type lysozyme 0.000000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005328788.1.77405
Sequence length 148
Comment lysozyme C [Ictidomys tridecemlineatus]; AA=GCF_000236235.1; RF=representative genome; TAX=43179; STAX=43179; NAME=Ictidomys tridecemlineatus; AL=Scaffold; RT=Major
Sequence
MKAFLILGLLLLSVTVQGKVYGRCELARALKRLGMDGYRGISLANWVCLAKWESSYNTRA
TNYNPGSRSTDYGIFQINSRYWCNDGKTPRAVNACGISCSALLQDDISQAVTCAKRVVRD
PQGIRAWVAWRNRCQNRNLSQYIQGCGV
Download sequence
Identical sequences I3N6D0
XP_005328788.1.77405 ENSSTOP00000019926 ENSSTOP00000019926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]