SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005329550.1.77405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005329550.1.77405
Domain Number 1 Region: 523-553,659-736
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000267
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005329550.1.77405
Sequence length 790
Comment solute carrier family 26 member 9 [Ictidomys tridecemlineatus]; AA=GCF_000236235.1; RF=representative genome; TAX=43179; STAX=43179; NAME=Ictidomys tridecemlineatus; AL=Scaffold; RT=Major
Sequence
MSQPRPRYVVDRTAYSLTLFDDEFEKKDRPYPVGEKLRNAFSCSSAKIKAVVFGLLPVLS
WIPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFRVFNNATNESYVDTAAMETERLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYAGPGSIVFT
FIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPSEMIVVVVATAISGS
YKMPRKYHMQIVGEIQSGFPAPVSPVVSQWKDMIGTAFSLAIVGYVINLAMGRTLASKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLYPLPKAVLGALIAVNLKTSLKQLTDPYYLWRKSKLDCCVWVVSFLSSFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRVQEIEGIKIVTYCSPLYF
ANSEIFRQKVVAKTGMDPQKVLLAKQKYLRKQEKRMMPTQHRKSLFMKTKTVSLQELQQD
FENASPTDPNNNQTPANGASISYITFSPDTSSAAPCEPSASAGSPSEPSDTLASVPPFVT
FHTLILDMSGVSFVDLMGIKALGKLSSTYGKIGVKVFLVNIHAQVYKDISHGGVFEDGCL
ERNHIFPSIHDAVLFAQANAREVAPGHSFQGAPGATELSLYDSEEDGPSYWDLEQEMFGS
MFHAETLTAL
Download sequence
Identical sequences I3MA87
XP_005329550.1.77405 ENSSTOP00000006884 ENSSTOP00000006884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]