SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005348787.1.66349 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005348787.1.66349
Domain Number 1 Region: 2210-2303
Classification Level Classification E-value
Superfamily C-type lectin-like 7.53e-33
Family Link domain 0.0001
Further Details:      
 
Domain Number 2 Region: 508-647
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-30
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1473-1521,1599-1713
Classification Level Classification E-value
Superfamily FAS1 domain 6.67e-29
Family FAS1 domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1724-1870
Classification Level Classification E-value
Superfamily FAS1 domain 3.66e-26
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 5 Region: 965-1122
Classification Level Classification E-value
Superfamily FAS1 domain 4.45e-22
Family FAS1 domain 0.0067
Further Details:      
 
Domain Number 6 Region: 385-501
Classification Level Classification E-value
Superfamily FAS1 domain 5.49e-19
Family FAS1 domain 0.0084
Further Details:      
 
Domain Number 7 Region: 2301-2463
Classification Level Classification E-value
Superfamily FAS1 domain 8.76e-17
Family FAS1 domain 0.007
Further Details:      
 
Domain Number 8 Region: 1131-1233
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000628
Family FAS1 domain 0.0092
Further Details:      
 
Domain Number 9 Region: 1545-1582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000356
Family Merozoite surface protein 1 (MSP-1) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005348787.1.66349
Sequence length 2574
Comment PREDICTED: stabilin-1 [Microtus ochrogaster]; AA=GCF_000317375.1; RF=representative genome; TAX=79684; STAX=79684; NAME=Microtus ochrogaster; AL=Chromosome; RT=Major
Sequence
MAESRILLLFLIFCLAGSNFIGGQRVRSKRCDVKTKFVTHSPCTACAAVRKRMCPLGWFR
NFPEKILLDCRYEVQLGGSLVSLSGCSQECWKDVVQKACCPGYWGSQCYECPGGAETPCN
GHGTCLDGIAGNGTCVCQENFSGSACQECRDPGRFGPDCQSVCSCVHGLCNDGPRGDGKC
LCFAGYTGTRCDQEVPVCQGLRCPQNSQCSAEAPTCKCLPGYTQQGSVCLARDPCKLSPC
SPLARCSVNPKGQAQCHCPENYHGDGKVCLPLDPCITNFGGCPSNSTLCLYKDPGKAVCI
CQPGLMSLNNDASAGCYAFCKPHSCDKSATCQVTADRKATSCVCKDGEVGDGRACYGHLL
HEVQRANQIGLMLARLKLAIAMLEQGCQEILTTSGPFTVLVPSFFVSSVPSRTMNVTLAQ
QLCKQHIIAGEHILEDVGPSNTRKWWTLAGQEITITFNHLRYTYKYEDQPQQTFTIQKAN
YVAANGVFHTVTALRRQLPPPLPGDPKKTVSEILASTEAFTRFETILENCGLPSILDGPG
PFTVFAPSNDAVDSLRDGRLIYLFTSGLSKLQELVRYHIYNHGQLTVEKLISKGRVLTMA
NQVLTVNISEEGRILLGPEGIPVRRVDVLAANGVIHMLEGILLPPTILPILPQHCDEEQH
QIVPGTCVDCQALNASVCPPNSVKMDIFPKECVYTHDPAGLNMLKKGCAHYCNQTITKRG
CCKGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHVCSNPNKHGKH
CQEDCGCVHGLCDNRPGSGGVCQRGTCAPGFQGRFCNESMGHCSPGGLAQLCHQHARCVS
QEGKARCICLDGFEGDGFSCTRSNPCSHPDRGGCSENAECIPGDLGTHRCVCHKGWSGDG
RMCVAIDECGLDTRGGCHVDALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRVGNGGCH
GLATCQAVGGGQRVCTCPPHFGGDGFSCYGDIFQELEANAHFSAFSQWFKNSSVTLPAGS
RVTALVPSEAAIRRLSREDQAFWLQPKMLPELVRAHFLQGAFSEEELARLSGQQVATLSP
KTHWQIHNISGKVWVQNVSVDVPDLLATNGILHIISQVLLPPRGDVQTGPGLLQQLDRVP
AFHLFREQLKHHKLVAQIEAAKAYTIFVPTNHSLETQGNSSILDIDIVRHHVILGEALSV
EVLRKGGHRNSLLGPAHWLVFYNHSGQPEVNHMPLEGPFLEAPGCSLFGLAGILTVGSSR
CLHSHAEALREKCINCTRKFRCTQGFQLQDTPRKSCVYRSGSSFSRGCSYTCAKKIQVPD
CCPGFFGTLCEPCPGGPGGVCSGHGQCQDRLLGSGECSCQEGFHGTACEMCELGRYGPTC
SGVCDCDHGLCQEGLRGNGSCVCNVGWQGLRCDQKIINPQCPKKCDPNANCIQDATGIPA
CICAAGYSGNGSYCSEVDPCAAGHGGCSPYANCTKVAPGQRTCTCQEGYTGDGELCQEIN
SCLIRHGGCHIHADCIPTGPQQVSCSCREGYSGDGIQSCELLDPCSQNNGGCSPYAVCRS
TGDGQRTCTCNPSHTVGDGITCHGRVGLELLRNKHATFFSLNLMEYKELKGDGPFTIFVP
HADLVSNMSQDELARIRAHRQLVFRYHVVGCRQLRSQDLLDQEYATALSGHTLRFSEKEG
SIYLNDFARVVNSDYEAVNGVLHFIDRVLLPPDVLHWEADTDTVPVPRRNITAATESFGY
KIFSRLVTVAGLLPMLQDATHRPFTMLWPTDSALQALPPDRQNWLYHEDHRDKLAAILRG
HVIRNIEALTSDLPNLGQLRTMYGNTISFSCSHARPGELLVGEDNTRIVQRHLPFEGGVA
YGIDQLLEPPGLGARCDRFETQTLQMKTCSVCGLEPPCPRGSQEQGSPKSCWRDYSKFWA
TPLHSLTMRGGAWIQPSFWNHHRLGRGCHRNCVKVIWKPSCCPGHYGIDCQACPGGPKSP
CSDHGVCLDGMSGSGQCKCHSGFAGTACELCAPGTFGPQCQACHCTPHGHCDEGLGGSGS
CFCDEGWTGPRCEVQLELQPVCTPPCATQAVCRVGNSCECSLGYEGDGRVCTVADLCRKG
HGGCSEHANCSQVGTMVTCTCLPDYEGDGWSCRARNPCLDGHRGGCSEHADCLNTGPNTR
RCECHVGYVGDGLQCLAELKPPVDRCMSKSAPCHRDALCTDLHFQEKRAGVFHIQAPSGP
YGLTFSEAREACEDQGAALASLPQLSAAQQLGFHVCFMGWLANGSAAHPVVFPAADCGDN
RVGVISLGVRKNLSERWDAYCYRVQDVACQCRAGFVGDGISTCNGKLLEVLATTANFSTF
YGMLLDYANATERGLGFLDFLDDERSFKTLFVPVNEGFVDNMTLSGSDLELHASNATFLS
VNASQGTWLPAHSGLSLFIRDEGPDNSSRVPLTPGTVVVSHILEWDILAFNGIIHTLASP
LLTPPPQSRPVLGHKPQPVALSMGIVVASGTLLGLVAGALYLRARGKPTGFGFSAFQAED
NADDDFSPWQEGSSPTLVSVPNPVFGSNDAFCEPFDDSLLEEDFPDTQRILKVK
Download sequence
Identical sequences XP_005348787.1.66349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]