SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005356738.2.66349 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005356738.2.66349
Domain Number 1 Region: 479-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.35e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 534-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.29e-19
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-19
Family KRAB domain (Kruppel-associated box) 0.0028
Further Details:      
 
Domain Number 5 Region: 142-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.74e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 100-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-17
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 576-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-17
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 315-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.87e-17
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 257-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-16
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 10 Region: 423-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000118
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 189-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000061
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 12 Region: 70-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000777
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005356738.2.66349
Sequence length 639
Comment PREDICTED: zinc finger protein 58-like [Microtus ochrogaster]; AA=GCF_000317375.1; RF=representative genome; TAX=79684; STAX=79684; NAME=Microtus ochrogaster; AL=Chromosome; RT=Major
Sequence
MLSFSDVAIEFSPEERECLEPAQWNLYRDVMLENYSHLEFLGLAVSKPHLVTFLEQRQEP
SDGKRQAAATVHPGTKPNDHSSYNKAIDCNSLQIQCQRIHTKEKPFKCEKCGKGLSSSKA
LSIHQRLHTGEKPYTCKECHKAFNTRSSLFIHQKDHTDEKTYKCGDCGRSFYYLSMLKQH
KIIHVKESPYKCKECGRCFFSFLCLRQHQARHTGKKAYKCEKCGKCFSFPSSFRRHQAIH
SEDSPYKCARSSKTLSHFTFLQEHQTIHSGKKSYKCEKCGKCFYFPSSLRRHKAIHSEDN
PYKCEECGKTLSSFKFLQEHQTIHTGKKSYKCEVCGKCFYFSLSLRRHKAIHSEDSPFKC
AECGKTFSYLTYLQDHQTIHTGEKAYKCEECGRCFHLSSSLRRHQTIHREDNPYNCEDCG
RRFSSSVSLKQHQTIHSAKSPYTSVHCGKWSSYSRDLQGHQTVHTGEKPYKCEECHKGFR
CLSSLSRHKRVHTGEKPYKCEECHKPFRCPSSLRRHKRVHTGEKPYKCEECHKAFRCHSS
FSRHMRVHTGEKPYKCEECHKAFHYHSSLKTHKRVHTGEKPFNCEVCHKAFNCYSSFRTH
ERVHTGEKPYKCEDCGRCFSSSSSFRRHKKAKIHSEKNS
Download sequence
Identical sequences XP_005356738.2.66349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]