SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005365535.1.66349 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005365535.1.66349
Domain Number 1 Region: 9-290
Classification Level Classification E-value
Superfamily TPR-like 1.31e-77
Family Tetratricopeptide repeat (TPR) 0.00000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005365535.1.66349
Sequence length 298
Comment PREDICTED: beta-soluble NSF attachment protein isoform X1 [Microtus ochrogaster]; AA=GCF_000317375.1; RF=representative genome; TAX=79684; STAX=79684; NAME=Microtus ochrogaster; AL=Chromosome; RT=Major
Sequence
MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAANMFKMAKNWSA
AGNAFCQAAKLHMQLQSKHDSATSFVDAGNAYKKADPQEAINCLNAAIDIYTDMGRFTIA
AKHHITIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAAYAAQLEQYQK
AIEIYEQVGANTMDNPLLKYSAKDYFFKAALCHFIVDELNAKLALEKYEEMFPAFTDSRE
CKLLKKLLEAHEEQNSEAYTEAVKEFDSISRLDQWLTTMLLRIKKSIQGDGEGDGDLK
Download sequence
Identical sequences A0A091CUX1 A0A096NVS6 A0A1S3G382 A0A1U7TPA2 A0A2K5CN83 A0A2K5HEW0 A0A2K5NNY9 A0A2K5R4U2 A0A2K6CT76 A0A2K6MDL8 F6YYC4 F8WFM2 G1SWV9 G3QZP4 H2QK28 I3N763 I7GPF9 L5KN23 P28663 Q5R4D1 Q9H115 U3FUU7
ENSPTRP00000022837 NP_001124927.1.23681 NP_001178895.1.100692 NP_001178895.1.4139 NP_001270955.1.63531 NP_062606.1.92730 NP_071363.1.87134 NP_071363.1.92137 XP_002710982.1.1745 XP_003509919.1.69978 XP_003829423.1.60992 XP_004061945.1.27298 XP_004441996.1.5094 XP_004601850.1.94378 XP_004668806.1.11716 XP_004687185.1.23501 XP_005334657.1.77405 XP_005365535.1.66349 XP_006911512.1.64745 XP_006984552.1.50099 XP_007624803.1.28591 XP_007954441.1.48129 XP_008058203.1.4292 XP_008582907.1.73410 XP_008994097.1.60252 XP_010606540.1.5607 XP_011374344.1.92234 XP_011748121.1.29376 XP_011818805.1.43180 XP_011907278.1.92194 XP_012293966.1.9421 XP_012508579.1.63892 XP_012882512.1.60039 XP_015005087.1.72884 XP_015339054.1.40921 XP_015977445.1.101085 XP_016067459.1.3490 XP_017396958.1.71028 XP_017715585.1.44346 XP_021049942.1.100879 XP_021512268.1.76796 XP_514551.3.37143 ENSRNOP00000006329 ENSMUSP00000028926 ENSPTRP00000022837 ENSOCUP00000007995 ENSRNOP00000006329 ENSMUSP00000028926 ENSSTOP00000020209 ENSMUSP00000028926 ENSPPYP00000012031 ENSDORP00000011146 ENSP00000366225 ENSSTOP00000020209 10090.ENSMUSP00000028926 10116.ENSRNOP00000006329 9598.ENSPTRP00000022837 9606.ENSP00000366225 ENSDORP00000011146 ENSPANP00000017151 ENSPPYP00000012031 gi|44917606|ref|NP_071363.1| ENSP00000366225 ENSP00000366225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]