SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005381166.1.28644 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005381166.1.28644
Domain Number 1 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 206-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 331-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 497-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-19
Family KRAB domain (Kruppel-associated box) 0.00066
Further Details:      
 
Domain Number 8 Region: 163-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.08e-19
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 9 Region: 134-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000122
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 94-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000163
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 539-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000577
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 250-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000331
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005381166.1.28644
Sequence length 583
Comment PREDICTED: zinc finger protein 791-like isoform X1 [Chinchilla lanigera]; AA=GCF_000276665.1; RF=representative genome; TAX=34839; STAX=34839; NAME=Chinchilla lanigera; AL=Scaffold; RT=Major
Sequence
MDSVAFQDVSVDFSQEEWALLDPLQKKLYRDVMRETFRNLAYIGSKWEDQNIKDQYIKQG
RNLRSFLIQRLCESKEGDQYGENFSQISDPTRTKKTTGGKPYECTVCGKGFMLHSSLTRH
IKSHPGHELDGFRYGEKPYKCKECGNTFSYLKSFQRHERNHTGENPYKCKQCGKTFIYHQ
PFQTHELTHIGEKPYQCKHCGKALSSPSSLRIHERIHTGEKPYECKKCGKAFSCPSSIQI
HERTHTGEKPYTCKECGKAFISRTSVQTHMITHNGDRPYKCKECGKAFIRPSFLRVHERI
HTGEKPYECKQCGKAFRCSTSIQIHERTHTGEKPYKCKECGKAFSARPAFRVHMRVHTGE
KPYKCKECGKAFSRLSYCRVHERTHTGEKPYECKKCRKTFNYPLDLQIHERNHTGEKPYE
CKECAKAFISLENFRRHMITHTGDGPYKCSDCGKAFIFLSALRTHERTHTGEKPYECKQC
GKAFSCSSYVQIHERTHTGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKQCGKAF
SLRSSFQRHERTHSGEKHFECKQCGKGFTLSTSLNKHVKLHSR
Download sequence
Identical sequences XP_005381166.1.28644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]