SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005387384.1.28644 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005387384.1.28644
Domain Number 1 Region: 507-646
Classification Level Classification E-value
Superfamily FAS1 domain 8.5e-28
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 2 Region: 2207-2296
Classification Level Classification E-value
Superfamily C-type lectin-like 2.89e-27
Family Link domain 0.00013
Further Details:      
 
Domain Number 3 Region: 1472-1520,1601-1712
Classification Level Classification E-value
Superfamily FAS1 domain 5.1e-27
Family FAS1 domain 0.0025
Further Details:      
 
Domain Number 4 Region: 1712-1867
Classification Level Classification E-value
Superfamily FAS1 domain 3.27e-26
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 5 Region: 964-1121
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-23
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 6 Region: 383-496
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-17
Family FAS1 domain 0.0081
Further Details:      
 
Domain Number 7 Region: 2294-2456
Classification Level Classification E-value
Superfamily FAS1 domain 6.67e-17
Family FAS1 domain 0.012
Further Details:      
 
Domain Number 8 Region: 1129-1252
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000017
Family FAS1 domain 0.0067
Further Details:      
 
Domain Number 9 Region: 1544-1581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Merozoite surface protein 1 (MSP-1) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005387384.1.28644
Sequence length 2565
Comment PREDICTED: stabilin-1 isoform X2 [Chinchilla lanigera]; AA=GCF_000276665.1; RF=representative genome; TAX=34839; STAX=34839; NAME=Chinchilla lanigera; AL=Scaffold; RT=Major
Sequence
MAEPWGRLLLCLLAFWLSGSSFTSGQKVQSKHCDVKTKFITHIPCTSCAIKKWMCPSGWL
LQRFPDKISQNCRYEVQLGDSLVSMSGCSMECWKDVVQKACCPGYWGSQCYECPGGANTP
CNGHGTCLDGLAGNGTCVCQENFSGSACQECRDPRRFGADCQSECSCVHGVCSSGPQGDG
SCLCFAGYTGPRCDQELPACRDLNCPLNSQCSPEAPTCRCLPGYTPQGSRCVAPNPCQSS
PCSSMARCSVSPEGQAQCHCPENYHGDGRVCLPQDPCTTNFGGCPSNSTVCVYQKPGKAT
CTCQPGLISVNQNPSAGCVAYCFPHSCDKSATCQVTPEGRTRCLCKQGEVGDGRACYGHL
LREIQKTNEMGTLFQRLRVAVAMLEQGCREILTTSGPFTVLVPLTSSISSRNMTALLAQQ
LCRQHVIAGQHILQDGGTPSTRRWWTLAGQEITISLNRLRYTYTYADQPKQTFTVHKANY
IAANGVFHVVNALRGQPLPALPGDPKQTVAQILASNEVFSRFETILENCGLPSILDGPGP
FTVFAPSNKAVDSLRDGRLIYLFTAGLSKLQELVRHHIYRRGQVTVDKLISKGRILTMAN
QVLAVNISDEGRILLGPEGTPLRQVDLPAANGVIHMLEGILLPPTILPILPKHCDEEQHK
IVMSSCVDCQALNTSVCPPDSVKLDIFPKECVYSLESVGFNVLKKGCAYYCNQTITKLGC
CKGFFGPDCTQCPGGFSNPCYGKGNCTDGIQGNGACLCFPDYKGIACHICSNPNKHGDQC
QDDCGCVHGLCDNRPGSGGVCQHGTCAPGFRGRFCNETVRDCGPTGLAQHCHQHAHCISQ
DGASRCVCLDGFDGDGYSCTRRNPCSQPDRGGCSENAECVPGDLGTHHCTCHKGWSGDGR
ICVAIDECGLDTRGGCHADALCSYVGPGQSRCTCKLGFAGDGYECSPIDPCRAGNGGCHG
LATCKAVGGGQRVCTCPPHFGGDGFSCYGDIIRELEANAQFSTFYQWFKSAGITLPADSR
VTALVPSESAIRRLSPENKAFWLQPKMLPYLVRAHFLQGALSEEDLARLGGQDVATLNPT
THWEIRNISGRVWIQNASVDVADLLATNGFLHIVNQVLLPPRGDLPVGQGVLQQLDRVPA
FRLFRELLQHHRLVPQIEAATAYTIFVPTNQSLEAQGNSSSLDADTVRHHVILGEALSVA
ALQRGGHRSSMLGPVHWLVFYNHSGQPEVNHTPLEGPLLEGPGYSLFGLSGVLTVGTSRC
LRSHEEALREKCINCTRKFRCTQGFQLQDTPKKSCIYRAGLAFSRGCSYTCVKKIQVPDC
CPGYFGTLCEPCPGGRGGVCSGHGQCQDRFLGSGECRCHEGFHGTACEMCELGRYGPNCT
GVCDCAHGLCQEGLRGDGSCVCNVGWQGLRCEQKVTGSQCVKKCNPNANCIQSSSGAPTC
VCAAGYSGNGSYCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCRDGYTGDGELCQEVNS
CLVHNGGCHMHAECIPTGPQQVSCSCREGYSGDGTRTCELLDPCSKNNGGCSPYAVCKST
GDGQRTCTCDSPRTEGDGFTCHTRVGLELFRDKLASFFSLHLLEYREIKGDGPFTVFVPQ
ADLVTNMSQDELARIRAHRQLVFRYHVVGCRKLHSQDLLDQGYATALSGHSLRFSEREGS
IYLNDFARVVSSDHEALNGVLHFIDRVLLPPDVLHWDPKAAAVPRRNVTTTAESFGYKIF
SRLVKMAGLLPMLQDTSHWPLTMLWPTDSALQALPLDRRAWLYHEDHRDKLAAILRGHMI
RNMEALASDLPNLGALRTMHGTPISFSCGRGRPGELTVGDGDARIVQRYLAFEGGLAYGI
DQLLEPPGVGARCDHFEARPLQLKICSVCGQEPPCPAGSREEGSPEACWRLSRFWTNSPL
RPFMLSSVWVRPNYWHQPQNLGRGCQRSCATTIWKPGCCPGHYGSECQVCPGGPSSPCSD
HGVCLDGMSGSGQCRCHVGFAGTACELCAPGAFGPQCQACRCTSHGRCDEGLGGSGSCFC
EEGWTGPRCEVQLELQPVCTPPCAPQAVCRAGNSCECSLGYEGDGHVCAVADLCQDGHGG
CSEHANCSQVGTVVTCTCLANYEGDGWSCRAHNPCADGHRGGCSEHADCLYTGPSTRRCE
CRAGYVGDGLQCLEEAKPPVDRCLGRPSPCHSDAVCTDLHFEEKWAGVFHLQATSGPYGL
NFSEAEAACEAQGGGLASFSQLFAARQLGFHLCHMGWLANGSAAHPAPDCGDGQVDVVSP
GTRRNLSERWDAYCYRVQDVACRCRDGFVGDGIGTCNGKLLDVLAATANFSTFYGMLLEY
ANATKRGLDFLDFLDDELTYKTLFVPVNEAFVDNMTLSGPDLELHASNTTFLSTNASRGT
LLPAHSGLSLVISDVGSDNSSSAPAAPGTVVVGRVVVWNIIAFNGIIHALASPLLTPPQA
GAVMAPERLPVAASVGAVVATGALLCLLAGALYLRVRGKPTGFGFSTFQAEDDADDDFAP
WQEGSPTLVSVPNPVFGSHDAFCEPFDDSLLEDEFPDTQRILAVK
Download sequence
Identical sequences XP_005387384.1.28644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]