SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005393510.1.28644 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005393510.1.28644
Domain Number 1 Region: 10-243
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.77e-93
Family Proteasome subunits 0.00000000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005393510.1.28644
Sequence length 261
Comment PREDICTED: proteasome subunit alpha type-4 [Chinchilla lanigera]; AA=GCF_000276665.1; RF=representative genome; TAX=34839; STAX=34839; NAME=Chinchilla lanigera; AL=Scaffold; RT=Major
Sequence
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK
Download sequence
Identical sequences A0A096NMW0 A0A0D9RQY7 A0A0P6JGW8 A0A1D5QLV9 A0A1S2ZWV8 A0A1U7TNW7 A0A287BIV4 A0A287D5F2 A0A2K5I8Q9 A0A2K5NL59 A0A2K5XLU7 A0A2K6CQX1 A0A2K6JQZ3 A0A2K6QX52 F6QQJ2 G1T519 G3QD78 H0X344 H2NNY6 H2Q9W6 P25789 Q3ZCK9 Q4R595 W5NS93
ENSBTAP00000019203 9544.ENSMMUP00000014072 9598.ENSPTRP00000012552 9600.ENSPPYP00000007603 9606.ENSP00000044462 9823.ENSSSCP00000001911 9913.ENSBTAP00000019203 ENSOGAP00000009518 gi|156713442|ref|NP_001096137.1| gi|4506185|ref|NP_002780.1| ENSMMUP00000014072 ENSPTRP00000012552 ENSSSCP00000001911 1iru_C 1iru_Q 5a0q_C 5a0q_Q 5gjq_D 5gjq_j 5gjr_D 5gjr_j 5l4g_C 5l4g_P 5le5_B 5le5_P 5lex_B 5lex_P 5ley_B 5ley_P 5lez_B 5lez_P 5lf0_B 5lf0_P 5lf1_B 5lf1_P 5lf3_B 5lf3_P 5lf4_B 5lf4_P 5lf6_B 5lf6_P 5lf7_B 5lf7_P 5ln3_C 5m32_B 5m32_P 6avo_O 6avo_Z ENSPPYP00000007603 ENSETEP00000010314 NP_001029553.1.59421 NP_001029553.1.76553 NP_001096137.1.87134 NP_001096137.1.92137 NP_001231397.1.46622 NP_001244491.1.72884 NP_002780.1.87134 NP_002780.1.92137 XP_001151019.1.37143 XP_002757825.1.60252 XP_002759892.1.60252 XP_002825770.1.23681 XP_003413792.2.64505 XP_003784601.2.62490 XP_003813862.1.60992 XP_004017868.1.66739 XP_004056651.1.27298 XP_004285308.1.21590 XP_004387518.1.4749 XP_004387519.1.4749 XP_004674792.2.23501 XP_004872150.1.39548 XP_005316906.1.77405 XP_005393508.1.28644 XP_005393509.1.28644 XP_005393510.1.28644 XP_005393511.1.28644 XP_005695157.1.57651 XP_005887679.1.15283 XP_005985057.1.78601 XP_006044451.1.26621 XP_006173555.1.101512 XP_006208839.1.17985 XP_006870948.1.41390 XP_006971633.1.50099 XP_006971634.1.50099 XP_007103518.1.24612 XP_007173497.1.59432 XP_007525840.2.11023 XP_008013904.1.81039 XP_008013905.1.81039 XP_008052506.1.4292 XP_008058058.1.4292 XP_008246673.1.1745 XP_009248348.1.23681 XP_010381449.1.97406 XP_010381450.1.97406 XP_010841589.1.44457 XP_010953505.1.22495 XP_010976133.1.51371 XP_011758893.1.29376 XP_011793800.1.43180 XP_011793801.1.43180 XP_011838102.1.47321 XP_011838103.1.47321 XP_011838104.1.47321 XP_011885241.1.92194 XP_011990608.1.54773 XP_012583965.1.23501 XP_012594866.1.48125 XP_012657363.1.62490 XP_012785124.1.84141 XP_014413771.1.101512 XP_015098634.1.17985 XP_015335850.1.40921 XP_016065067.1.3490 XP_017500946.1.32401 XP_017500947.1.32401 XP_017741256.1.44346 XP_017741257.1.44346 XP_017821702.1.60252 XP_018866373.1.27298 XP_019805927.1.83887 XP_019805934.1.83887 XP_019839355.1.53367 XP_020739553.1.74333 ENSBTAP00000019203 ENSPTRP00000012552 ENSVPAP00000007680 ENSOGAP00000009518 ENSOARP00000001033 ENSP00000044462 ENSP00000453887 ENSOCUP00000011410 ENSSTOP00000009511 ENSVPAP00000007680 ENSP00000044462 ENSETEP00000010314 ENSMMUP00000014072 ENSSTOP00000009511 ENSSSCP00000001911 002045277|e5ln3C1|210.1.1.3|C:1-261 cath|current|1iruC00/2-251 cath|current|1iruQ00/2-251 ENSCJAP00000019175 ENSCJAP00000040817 ENSP00000044462 ENSP00000453887 ENSPPYP00000007603 1iruC ENSCJAP00000019175 ENSCJAP00000040817 ENSGGOP00000000188 ENSGGOP00000000188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]