SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005394825.1.28644 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005394825.1.28644
Domain Number 1 Region: 42-86
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005394825.1.28644
Sequence length 119
Comment PREDICTED: DNA-binding protein inhibitor ID-3 [Chinchilla lanigera]; AA=GCF_000276665.1; RF=representative genome; TAX=34839; STAX=34839; NAME=Chinchilla lanigera; AL=Scaffold; RT=Major
Sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKSPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTSELAPELVISNDKRSFCH
Download sequence
Identical sequences G5BHY6
XP_004637665.1.9945 XP_004850616.1.39548 XP_005394825.1.28644 XP_010624281.1.5607 XP_010624282.1.5607 HGL_H00000363689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]