SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005425773.1.5688 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005425773.1.5688
Domain Number 1 Region: 196-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000113
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 838-890
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000449
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 331-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000793
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 674-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000883
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 5 Region: 895-944
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000015
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 805-846
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000276
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 7 Region: 712-770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000702
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005425773.1.5688
Sequence length 1174
Comment PREDICTED: zinc finger protein ZFAT isoform X3 [Geospiza fortis]; AA=GCF_000277835.1; RF=representative genome; TAX=48883; STAX=48883; NAME=Geospiza fortis; AL=Scaffold; RT=Major
Sequence
MCKLCNLFSPNKSELLSHVSEKHTEEGTGVDDIIIPLQPLTAPTNTSKDGEEFLVAKRKR
GRPKGSTKKFCVDEDVAENNPVPSKETPAGTEEGPEPSEVSPGSLECRKCNRKFSNTRQL
TKHICIIVLNEGEEEGDGGARKIVPLEASPHESDPKTPDTTVQDPSQRKGYQEYAIQQTP
YEQAMKTSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCSYCSYASAIKAN
LNVHLRKHTGEKFSCDYCTFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLIKHM
KETHDLQDKKVKDVFDELRLMTREGKRQLLYDCHICERKFKNELDRDRHMLVHGDERPFA
CELCGHGATKYQALELHVRKHPFVYVCSVCLKKFVSSVRLRAHIKDVHADLQEDFVFDSS
INQSFCLLEPGGDIQPEALGEQQTQTAGESTVTSSDAVNTPQPSVSKGESAAADVNHDGQ
HNGDVKLDAVLSLELENPLVKNVAETLCQTTDVAVPNIQPCVTSDCFLLKNGTAGPEEFK
GSPPNEEEVAQCSSVNEQGEEINLLLSEDKGLDVSQNNTMTESLPVLEETIQSVPPGESE
TSNPPIQNSAEPTDPLAAAEAGAATSPQAASSNTASASGGNGSVAFMQILDSLQKRQMNT
ELRERIRKVYGDLECEYCGKLFWYQVHYDMHVRTHTREHLYYCSQCNYSSITKNCLKRHV
IQKHSNILLKCPTEHCDYSTPDKYKLQAHLKVHSDLDKKSYSCPVCEKSFSEDRLIKSHI
KTNHPEVSMTTISEILGRRVQLKGLIGKRAVKCPHCDFYFMKNGSDLQRHIWAHEGVKPF
KCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCT
VCDYTAAQKPQLLRHMEQHVSFKPFRCAHCHYSCNISGSLKRHYNRKHPNEEYVNAGSGE
PAAEALIQQGGIKCPVCSFVYGTKWEFNRHLKNKHGMKLVENDGETKWELTAEVSEEAST
QYLHITEAGEDVQGTQAAVAALQNLRYTSENSERLDPAAVNILQQIIELGSESHDATAVA
SVVTMAPGTVTVVKQVKEEEQPAKHTLMIQETLQQAAVELSEQHHLVVSSDEVEGIETVT
VYTQGGEASEFIVYVQEAVQPVEEQAVEESVQEL
Download sequence
Identical sequences XP_005425773.1.5688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]