SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005448760.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005448760.1.78416
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 1.44e-100
Family Sema domain 0.00091
Further Details:      
 
Domain Number 2 Region: 1386-1509,1675-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-35
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 858-949
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000191
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 4 Region: 1041-1121
Classification Level Classification E-value
Superfamily E set domains 0.000000000000255
Family E-set domains of sugar-utilizing enzymes 0.056
Further Details:      
 
Domain Number 5 Region: 949-1022
Classification Level Classification E-value
Superfamily E set domains 0.000000000042
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 6 Region: 511-557
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000419
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005448760.1.78416
Sequence length 1899
Comment PREDICTED: plexin-D1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MPPSIEIAVLLLGVLALETRRSASALHIQQAFASPNQTNNFVVDPVSRRVYLATVNTIYQ
LNGTLTAEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGIVVVCGS
VYQGFCELRKIENISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGSTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESQPNSILARICLDTENPRKPTGPESR
KLTESYIQMPLQCGFNGNIYNRVLSVYPTEIHAGDGKSPEPYLFGVFSKGDRKSALCAFK
FGDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGSACIQKGNLVLQPEQLDCGAAHLQHP
LALRRPLRAIPLLEYPGLSSVSVDNVQNHTVVFLGTSNGRLRKLTLLPNMTTANQWMLKL
RANEAVHHIMTFDPNDSNFLYVMTSHHMLRVKVADCDQWKSCSDCLGAGDAHCGWCTLEN
RCTIQKECAQELLARSWISMGEGPQQCPSMTLTPAEISISADIKDVGILINGSVPDLIGS
RVECEYEPGVSTVATVHLDSGPSQIQTCPLLARNRYQPILPGKDHLTVSVAIKVNGTSVV
SGSFIIYDCERTGRIHPKTPCMSCLSTRWKCYWDQNSHLCVSSKDDANQNLLENAASCPS
LVSSEVPPSPSGMVQDFTLSLSNIQENEKLECDFGTEQRYEATWLNSTTVKCSGVTLSTN
QRSQIYHLNLRRRGAFIRHREDVFIDSPQPMKVEMYNCGVGSSDCSQCWGREDQGHLCGW
CDSICKPRDECQPIRDQCPNPEIHEISPLSGPVEGGTLLTVQGRNLGRRAKAVRVSIGDV
NCTLLPQFYTVSTELVCVTGRAADNRSDIVQVDVEQSGTGKSKETFSYLIPKLLSMEPER
GLRAGGTKVTINGEHLNIGSEVKVKVNTTQECIITKKTAQTIECVMPPASQAHTDPVTVC
VEFENKTCEGPELSTTYTYERNPIITSIRPKMSFRSGGRNITVTGQGFDLVQSVTMQVVG
IGHSQCEVLTPSTIACRSPPSNQSQPTSVQFLLNGVLYTNDRPSSSDTDDEEEEEEPHIG
HFPLEYVEDPQFFTANKEKLIKHHSGEQLTLIINKVPSDLELMPEEYSVMIGSYPCNITF
HNDQLFHCTINGLSSSSERELPVFVQVGNFRRKVATVQLGGSEMAIVVSIVVCCVLLLLC
TVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGI
PFLEYKQFVTRTFFPKMCSDYEKSLVQPVYENDALGPRALPETHPLLQDWQATNTTRPNI
EEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDL
LVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQIN
KGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKEK
ILEAFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIPE
GASLAMSMQDKKENTLGRVKDLDTEKYVHLVLPHDELMETKKSHRQSHRKKVLPEIYLTR
LLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNS
LPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAK
EIPEYKKRVQCYYQQIQDMPPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRN
QVVNALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_005448760.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]