SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005455837.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005455837.1.78416
Domain Number 1 Region: 250-492
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.43e-86
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 153-255
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000314
Family Hepsin, N-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 107-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005455837.1.78416
Sequence length 495
Comment PREDICTED: transmembrane protease serine 4 isoform X1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MYGRCDQSQVDKEIGSSVSHTNIPTQSKTRHNREEQGTTAAQLPEETSRPLNPTNPGPRP
GRHRRPMTAPNTPREKRAKIKKVLITTLTVLLILGILAIAAYFIKNLIESKYFFCTRSVK
FIPLDKTCDGHIDCAGAEDEITCMTTFKVNTTFPVRLQSNDQVLQVYSPDSGWRTVCADD
WTQAHTQTACTQLGYTMKPTSKNILVSSLMSPMKTGPFTAVRPGTSNTPIQQATADRSVC
NSGSVVSLSCSDCGKVGPEHRIVGGTDTSIDHWPWQVSLQRSGQHTCGGSLVSPRWVVTA
AHCFTGNNRELRQWAVVSGQTNIITLGGSSVDRVIVNGDYNAETNDYDIALMRLTRPITV
SDIRRPVCLPPKDYIITAGTYMTVTGWGYQRENGAVSDILQEANVPLIAQSACSSYTLYG
SAITNRMLCAGFPEGKVDACQGDSGGPLVHITESNWNLVGVVSWGVGCARKGKPGVYSNV
EMMLNWIQTVIEKHP
Download sequence
Identical sequences I3JFI9
XP_005455837.1.78416 ENSONIP00000007630 ENSONIP00000007630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]