SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005458596.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005458596.1.78416
Domain Number 1 Region: 455-590
Classification Level Classification E-value
Superfamily TIMP-like 2.12e-25
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 230-326
Classification Level Classification E-value
Superfamily Immunoglobulin 5.5e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 409-462
Classification Level Classification E-value
Superfamily BPTI-like 2.84e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 4 Region: 344-403
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000088
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.018
Further Details:      
 
Domain Number 5 Region: 146-198
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000582
Family Ovomucoid domain III-like 0.031
Further Details:      
 
Domain Number 6 Region: 55-102
Classification Level Classification E-value
Superfamily Elafin-like 0.00000196
Family Elafin-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005458596.1.78416
Sequence length 592
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MRNFPLQFLADRHIKGANCHSAPNSSKVRWTRAYLLTLLFCDLLEVSLCASVAGTKVEHE
GFCPNKLNANLWVDAQSTCERECDIDEDCADFEKCCTNVCGFNSCVAARFSDGTPAQPHE
QGEGQGDATSASTATCEGFICSQQGATCDIWDGQPICKCQDRCEKEPNFTCASDGLTYFN
RCYMDAEACIRGVTLTVVPCRFYLAGPPTSPLPQDTTVHPTPASSQEDPMPPTLYSNPHH
QSIYVGGTVNFHCDVIGVPRPDVTWEKQSDRRERLVMRPDQMYGNVVITNIGQLVIYNAQ
VWDTGIYTCIARNSAGVLRADYPLSVIRRSDDDFSEDPEMPMGRPFSPADCLAEVDLSVC
SGERHVDWYYDSKLGSCVTFSSGGCEDSRNRFETYEECKASCQREDMGICSLPAVQGPCK
AWEARWSWNSITKQCQAFVYGGCHGNANNFHTKKECEANCPQPKRKPCKTCRVKGKMVPS
LCRSDFAIVGRLTELVEDLDSGLARFSLEEVLRDEKMGLTFFNTKHLEVTIAKIDWSCPC
PNITVEENPLLVMGMVQDGMAIIHSDSYVRAINERKLKKLRDALGKKACDSS
Download sequence
Identical sequences XP_005458596.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]