SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005467604.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005467604.1.78416
Domain Number 1 Region: 171-310
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-26
Family UBX domain 0.011
Further Details:      
 
Domain Number 2 Region: 6-55
Classification Level Classification E-value
Superfamily UBA-like 1.6e-16
Family UBA domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005467604.1.78416
Sequence length 311
Comment PREDICTED: UBX domain-containing protein 1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MAELTTLESLLEMGFDRNRAEKAVANTGNQGIEQAMDWLMEHENDPDIDEPYVPPVGNVL
GGEAQSQPSTADSSEGQEGQESFEGIAGGDIGYIETEDGVKRPMTEEEKNEQVKRLEELM
RVKQAERRERERAEEVEREKQRRKQGQELQQIRQKLQDDEMKKIAEQRQREKMEDKLARQ
RVKEKIARDREERAQKFGGGAPSSTAASSQNAQPSPSSPTSQGPPPTKKEYDESRIQVRL
LDGSTITTVFKAQEPLAAVRVYVQMNGNTPEGQDFTLLSPYPRHVYTELDMEKPLKELGL
VPSAVLVVAKK
Download sequence
Identical sequences I3JCR4
XP_005467604.1.78416 XP_005467605.1.78416 XP_013126413.1.78416 ENSONIP00000006654 ENSONIP00000006654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]