SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005476546.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005476546.1.78416
Domain Number 1 Region: 12-174
Classification Level Classification E-value
Superfamily RUN domain-like 5.1e-39
Family RUN domain 0.00035
Further Details:      
 
Domain Number 2 Region: 1368-1477
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.07e-27
Family Supernatant protein factor (SPF), C-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1175-1239
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000106
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0041
Further Details:      
 
Weak hits

Sequence:  XP_005476546.1.78416
Domain Number - Region: 644-836
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005476546.1.78416
Sequence length 1481
Comment PREDICTED: FYVE and coiled-coil domain-containing protein 1 isoform X1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MASISSVGDKQLQRIIRDLHDAVIELSKEHRECGEPITDDFANLHKFFYKLEYLLQFDQK
EKTTFLGQRKDYWDYFCDCLIKIKGANDGIRFVKSIPELKTSLGKGRAFIRYSLVHQRLA
DTLQQCFMNQKVTSDWYYARSPFLKSHLTGDIINNLYELNQIQFDVAARGYDLDADWPKF
ARRTIGSGSSAYLWKPPSRCSSVNSLVSSYSHSQGQEFLPVPDLSHSGLDELGDPSSCSI
AENLRIELDQSELRQQELLVRVQELGKEAAELKDIVKYLQEQLSAQKSANSTSTAVQSNP
ETYSEERVNHHQTCREPIRSELQDRLRTAENKNMELLSKLDEALKERGQQTASYCESAWK
IQELLDKLKSVEEERLEAKREAEDKARHCECLSQELKLREEELRNAEGKLAEVKAGADDE
REAALTRLEELQSAVGRIQGALTLKEKETGNLRAQLQDLQASLECRERQAEELRKMLQEE
REEVEKQCSLSSSQNEELESLSLDLRKTLKSREKELAASSERIKHLEEQLDKLNVGKETV
APRIIDDEITSCSQSENTADDKTQFSSLMEINAKLLQTVRKSEVSISELTESRATLLDQL
ASLKASEKHLRSRVEAAKMSVEDREKKLLDENLKLEEMVQKAFMQREQSDAQLKKLEHEN
TELLGSQSTLKEQLATTQQELDSFTAKAEKLDKNLIASQKSQAELLEKLQETEAKLRDQT
VKCELLQGRTDELESRSGELHDEKGAAESNEKMQKLHSEHQTSSVESKEAPFRLVIAEAQ
LELNVREVTRLQEEVVELRAQLLSGNEERMKAQALQEVTEASREDLRVLVEQLKAQVEEL
NRRHVDEILRSREREEALIRERDGEAQARVGLAAEVTASREELDKLKMRYNALCLENSES
REALHRANTETAELGVHVCMLTAENEEARLRWEGQSTKLQELEEAAQEVGRLNACMEQLR
KENLELRSQLPNTEDLMASKEKLEKQLREAQQEVEAVREMNQEENQQLRLQLSSEAVSHE
NQLQSTIQELEDVKLQLQTEHEKVVPLENNLKGLEAENQRYCRQIEEKNIQMAESENLIQ
QKEDEIIHLKGNLSRSEEALAVAQRACQEMAENLRRVTQDKQSFDMKMAAELDDLYRTKI
NLEERLVELIREKDALWQKSDALEFEQKLRDEESERDVNYCLGCHTQFSWWFRKYSCRLC
GRPFCYYCCSNTVSTQQGGNRERCCKDCYNQHSAVVERHPQEEVAHSTPGTPFRRLLQAG
LAVSGVSGAGGGDKLDDGVFDIITDEEVSGVYDSESLSFVTACSPGHGQQGAAQLNSSAS
AGDLTSEDTEDLSAAVQDAEICLLKSGELTFSVHFTVDDIAAFGDSPRELFIKSSCYSTI
PITTSNPGPTVSWTFTSEPKSISFSVVYRESTEIPLEQAKVLIPLTRCNSHKETIQGELK
VRNPGEYTLIFDNSFSRFISKKVLYHLSLDKPVVYDGTDLL
Download sequence
Identical sequences I3JS08
ENSONIP00000011653 ENSONIP00000011653 XP_005476546.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]