SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005479949.1.73095 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_005479949.1.73095
Domain Number - Region: 93-178
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0836
Family Gonadodropin/Follitropin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005479949.1.73095
Sequence length 184
Comment PREDICTED: gremlin-1 isoform X1 [Zonotrichia albicollis]; AA=GCF_000385455.1; RF=representative genome; TAX=44394; STAX=44394; NAME=Zonotrichia albicollis; AL=Scaffold; RT=Major
Sequence
MVRTLYAIGALFLLMGFLLPAAEGRKRNRGSQGAIPPPVKDQPNDSEQMQTQQQSGSRHR
ERGKGTSMPAEEVLESSQEALHITERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYG
QCNSFYIPRHVRKEEGSFQSCSFCKPKKFTTMTVTLNCPELQPPRKKKRITRVKECRCIS
IDLD
Download sequence
Identical sequences H0ZNB3
59729.ENSTGUP00000012089 XP_002200528.1.42559 XP_005417568.1.5688 XP_005479949.1.73095 ENSTGUP00000012089 ENSTGUP00000012089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]