SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005536867.1.94140 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005536867.1.94140
Domain Number 1 Region: 192-280
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.58e-18
Family UAS domain 0.016
Further Details:      
 
Domain Number 2 Region: 372-490
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.91e-18
Family UBX domain 0.006
Further Details:      
 
Weak hits

Sequence:  XP_005536867.1.94140
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily UBA-like 0.000221
Family TAP-C domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005536867.1.94140
Sequence length 529
Comment hypothetical protein, conserved [Cyanidioschyzon merolae strain 10D]; AA=GCF_000091205.1; RF=representative genome; TAX=280699; STAX=45157; NAME=Cyanidioschyzon merolae strain 10D; strain=10D; AL=Complete Genome; RT=Major
Sequence
MAATEDSQNETLALFKNIAALDDNEVARAILSAHNWNIERAVDAFLTRGVEGALQPPNRT
GSLEFASTSDTSGTTPDASELSSAPVSGQLHASRLSESQPLTPALAETSTPERALQPALA
QATPSGVLGHLRRLLALPFQALRMVLAWCASLVTRIMGIDRYYRYAGRSRAVGAAAVAEL
EENLRTRYGMTIRYPTIYHGTFKEALEHSTQRCKLVLLYLHSEIHHATDRFVREILSDES
FIQFVNENFVFYAASVNRSPEAVELASYFTPAGYPYLAVVFASRRWPLGQLIDLRVLSDL
DRSMRGGRDAPITATDVLLWLQNVLLEYGDALRTAHTMRERRRSAQRLREEQDREFQEAL
AADQAAERARREFEQRAREEAAEQDQRRRERMAMLDRKRAALGPEPEPGEHVVTVLLRLP
DGKSTQRRFELSRSFRDLFDWAETSADIDFDRFELTTNFPKRAYSPASHSAMTLAEAGFK
QRVALLVTEIGWTRALPDASGKADVSDGNGNVEQKHLEQGNSSESKKQV
Download sequence
Identical sequences M1UT04
CML244CT gnl|CMER|CML244C XP_005536867.1.94140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]